fusion protein, its use and production method, pharmaceutical composition, nucleic acid, and kit

专利摘要:
  FUSION PROTEIN, ITS USE AND ITS PRODUCTION METHOD, PHARMACEUTICAL COMPOSITION, NUCLEIC ACID, AND KIT.The present invention relates to bispecific fusion proteins that inhibit activation of the complement pathway and vascular endothelial growth factor (VEGF), pathway and methods for using these fusion proteins.
公开号:BR112014013205A2
申请号:R112014013205-4
申请日:2012-11-30
公开日:2020-10-27
发明作者:Jeng-Horng Her；Huang-Tsu Chen
申请人:Protevobio, Inc.；Innovent Biologics, Inc.；
IPC主号:

专利说明:

[001] This Patent Application claims the priority benefit of U.S. Provisional Patent Application serial number 61 / 629,932, filed on December 1, 2011, which is incorporated into the present invention by reference in its entirety. FIELD OF THE PRESENT INVENTION
[002] [002] The present invention relates to bispecific fusion proteins that inhibit the activation of the complement pathway and the vascular endothelial growth factor (VEGF) pathway, the compositions that comprise these fusion proteins, as well as the methods to produce and use it. BACKGROUND OF THE PRESENT INVENTION
[003] [003] The complement system is a functional effector of the innate immune system that consists of a series of plasma proteins and cell membrane proteins. Complement activation leads to a series of release from the cascade triggering of cytokine protease activation and amplification of the activation cascade. The end result of complement activation is the activation of the cell death membrane attack complex (MAC), inflammation caused by anaphylatoxins C3a and C5a, and opsonization of pathogenic organisms. MAC is essential to eliminate invading and damaged pathogens, necrosis and apoptosis.
[004] [004] A delicate balance between defending against the pathogen and preventing excess inflammation has to be achieved through the complement system (Ricklin, D., et al., (2007) Nature Biotechnology, (11): 1265 to 1275). Many inflammatory, autoimmune diseases,
[005] [005] The complement system can be activated through three different pathways: the classical pathway, the alternative pathway and the lectin pathway. All three pathways pass through critical protease complexes of C3 - convertase and C5 - convertase that cleave complement components C3 and C5, respectively. The classical pathway is initiated through the binding of Ciq of IgM or IgG antibodies that leads to the activation of the C1 complex, which cleaves the complement components C2 and C4, producing C2a, C2b, C4a and C4b. C4b and C2b then form the C3 pathway - classic convertase, which promotes the cleavage of C3 into C3a and C3b. C3b then forms C5 - convertase by binding to C4bC2b (C3 - convertase). The lectin pathway is identical to that of the classic downstream C3 pathway - convertase, and is activated by binding mannose-binding lectin (MBL) to the mannose residues on the pathogen surface. The serine proteases associated with MBL MASP - 1 and MASP - 2 can then cleave C4 and C2 to form C3 - convertase as in the classical pathway. Unlike classical and lectin pathways that are specific immune responses that require antigens, the alternative pathway is a non-specific immune response that is continuously active at a low level. Spontaneously hydrolysis of C3 leads to C3a and C3b. C3b can bind factor B and then the cleavage of Factor B to Ba and Bb with the aid of factor D. The complex C3bBb that can be stabilized through the binding of factor P (properdin) is C3 - convertase from the alternative pathway that cleaves C3 to C3a and C3b. C3b can join the C3bBb complex to form the C3bBbC3b complex which is the alternative pathway C5-convertase. C5 convertases from all three pathways can cleave C5 to C5a and C5b. C5b then recruits and assembles C6, C7, C7, C8 and the various C9 molecules to assemble the MAC. This creates a hole or pore in the membrane that can kill or damage the pathogen or cell. The complement system is closely regulated through two mechanisms: the deceleration of activity acceleration (DAA) and cofactor activity (CA). DAA refers to the ability to promote the dissociation of C3 - convertase or C5 - convertase. CA refers to the ability to facilitate the factor | to cleave C3b or C4b for inactive fragments. For a review of the complement system, see Wagner, E., et al., (2010), Nat. Rev. Fármaco Discov, 9 (1): 43 to 56.
[006] [006] Type 1 human complement receptors (CRI) is the only complement regulator, which has DAA for both classic and alternative C3 convertases and C5 convertase and CA for C3b and C4b, and therefore has generated interest in therapeutic applications (Krych - Goldberg, M., et al., (2001), Inmunological Reviews, 180: 112 to 122). A naturally occurring soluble human CR1 (s-
[007] [007] The vascular endothelial growth factor (VEGF) is one of the most important proteins that promote angiogenesis, which is a strongly regulated process of developing new blood vessels from a pre-existing vascular network (Ferrara, N. , (2004), Endocrine Reviews, 25 (4): 581 to 611). Angiogenesis is necessary during development and normal physiological processes, such as wound healing, and is also involved in the pathogenesis of a number of diseases, including AMD, RA, diabetic retinopathy, tumor growth and metastasis . Inhibition of angiogenesis has been shown to be effective in therapeutic applications.
[008] [008] The VEGF pathway and the complement pathway contribute to the formation of diseases with similar etiologies. Therefore, there is a need for the development of therapeutic agents that target both the VEGF pathway and the complement pathway. Fusion proteins are provided in the present invention, which inhibit the activation of both complement and VEGF pathways. The fusion proteins of the present invention can be used as a therapeutic agent for use in the treatment of complement and diseases related to VEGF. BRIEF SUMMARY OF THE PRESENT INVENTION
[009] [009] The present invention describes, inter alia, a fusion protein comprising a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a domain that extends half-life, compositions comprising fusion proteins, methods of fusing proteins, and methods of using these fusion proteins to inhibit complement activation and the VEGF signaling pathway (for example, inhibition of VEGF activity).
[0010] [0010] Accordingly, in one aspect, the present invention provides a fusion protein comprising a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a half-life domain, in that the fusion protein inhibits complement activation and the VEGF signaling pathway (for example, inhibition of VEGF activity). In one embodiment, CID comprises at least one short consensus repeat (SCR) of a human complement regulatory protein selected from the group consisting of CR1, Factor H, C4 - BP, DAF and MCP.
[0011] [0011] In another aspect, the present invention provides a fusion protein comprising, from Terminal N to Terminal C, a VEGF inhibition domain (VID), an immunoglobulin Fc region, and a complement inhibition domain (ICD), where the fusion protein inhibits complement activation and the VEGF signaling pathway (for example, inhibition of VEGF activity). In one embodiment, CID comprises an amino acid sequence selected from the group consisting of SEQIDNO: 1a 6 and 13 to 16, or an amino acid sequence having at least 90% identity with an amino acid sequence selected from the the group consisting of SEQ ID NO: 1 to 6 is 13 to 16. In any of the embodiments of this present invention, VID comprises a portion of the extracellular domain of a human VEGF receptor. In one embodiment, VID comprises an immunoglobulin (lg) of domain 2 of human VEGFR - 1 and human type 3 domain of VEGFR - 2 human. In another embodiment, the VID comprises the amino acid sequence of SEQ ID NO: 11 or 38, or an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO:. 11 or 38. In any of the modalities in the present invention, the Fc region is a human IgG1, IgG2, IgG3 or IgG4 human Fc. In one embodiment, the Fc region comprises a sequence of amino acids selected from the group consisting of SEQ ID NOs: 7, 39, 41 and 42, or a sequence of amino acids having at least 90% identity with the sequence of amino acids selected from the group consisting of SEQ ID NOs: 7, 39, 41 and 42. In any of the embodiments described in the present invention, the fusion protein further comprises a peptide linker between the domains. In one embodiment, the peptide binding agent is between the Fe and CID regions. In another embodiment, the peptide linker comprises the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO: 8. In one embodiment, the Fusion comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or an amino acid sequence having at least 90% identity with the amino acid sequence selected from among the group consisting of SEQ ID NOs: 12, 33 to 37 and 40.
[0012] [0012] In another aspect, the present invention provides a fusion protein produced by culturing a host cell comprising a nucleic acid that encodes all of the fusion protein described in the present invention under a condition that produces the protein fusion, and the recovery of the fusion protein produced by the host cells. In one embodiment, the fusion protein comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or an amino acid sequence having at least 90% identity to the sequence of amino acids selected from the group consisting of SEQ ID NO: 12., 33 to 37 and 40 In another embodiment, the fusion protein further comprises a signal peptide at its N-Terminal that comprises the selected amino acid sequence from the group consisting of SEQ ID NOs: 9, 10 and 43. In another embodiment, the fusion protein produced by the recovered host cell may comprise a signal peptide that is partially cleaved at Terminal N In one embodiment, the host cell is a mammalian cell. In another embodiment, the mammalian cell is a CHO cell.
[0013] [0013] In another aspect, the present invention provides a
[0014] [0014] In one aspect, the present invention also provides compositions comprising any fusion protein described in the present invention and a pharmaceutically acceptable carrier. In one embodiment, the fusion protein comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or an amino acid sequence having at least 90% identity with the amino acid sequence selected from the group consisting of SEQ ID NO: 12. 33 to 37 and 40 In one embodiment, the fusion protein is a dimeric form. In another embodiment, the dimeric fusion protein comprises two identical fusion proteins. In another additional embodiment, the dimeric fusion protein comprises two different fusion proteins. In another additional embodiment, the dimeric fusion protein, comprises at least one fusion protein comprising the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or one amino acid sequence having at least 90% identity with the amino acid sequence
[0015] [0015] In another aspect, the present invention provides a nucleic acid that encodes any of the fusion proteins described in the present invention. In one embodiment, the nucleic acid encoding a fusion protein comprises a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a half-life domain, in which the Fusion protein inhibits complement activation and the VEGF signaling pathway (eg, inhibition of VEGF activity). In one embodiment, the nucleic acid encoding a CID that comprises at least a short consensus repeat (SCR) of a human complement regulatory protein selected from the group consisting of CR1, the Factor H, C4 - BP, DAF and MCP. In another embodiment, the nucleic acid encoding a CID comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 1a 6 e13a16, or an amino acid sequence having at least 90% identity with an amino acid sequence selected from the group consisting of SEQIDNO: 1a 6 and 13 to 16. In any of the embodiments of this invention, the nucleic acid encoding a VID comprises a portion of the extracellular domain of a human VEGF receptor. In one mode, the nucleic acid encoding a VID comprises an immunoglobulin (Ig) from the human VEGFR - 1 domain 2 and human VEGFR - 2 Ig type 3 domain. In another embodiment, the nucleic acid encoding a VID comprising the amino acid sequence of SEQ ID NO: 11 or 38, or an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO: 11 or 38. In any of the modalities of this invention, the nucleic acid encoding a half-life extending domain comprises an immunoglobulin Fe region. In one embodiment, the nucleic acid encoding an Fc region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 7, 39, 41 and 42, or an amino acid sequence having at least 90% identity with the amino acid sequence selected from the group consisting of SEQ ID NOs:. 7, 39, 41 and 42. In any of the modalities of this invention, the nucleic acid encodes another peptide linker comprising the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO: 8. In any of the embodiments of this invention, the nucleic acid encoding a fusion protein comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or an amino acid sequence having at least 90% identity with the amino acid sequence selected from the group consisting of SEQ ID NOs: 12.33 to 37 and
[0016] [0016] In another aspect, the present invention provides a vector that comprises a nucleic acid that encodes any of the fusion proteins described in the present invention. In one embodiment, the fusion protein comprises a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a half-life domain, in which the fusion protein inhibits complement activation and VEGF signaling pathway (for example, inhibition of VEGF activity). In any of the embodiments of this invention, the vector comprises any of the nucleic acids described in the present invention that encode a fusion protein as described in the present invention. In one embodiment, the vector comprises a nucleic acid encoding a fusion protein comprising the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or an amino acid sequence having at least 90% identity with the selected amino acid sequence from the group consisting of SEQ ID NOs:. 12, 33 to 37 and 40 in all aspects, the present invention provides a host cell comprising any of the nucleic acids described in the present invention, which encode a fusion protein as described in the present invention. In one embodiment, the host cell comprises a nucleic acid encoding a fusion protein comprising the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or a sequence amino acids having at least 90% identity with the selected amino acid sequence from the group consisting of SEQ ID NOs: 12.33 to 37 and 40.
[0017] [0017] In yet another aspect, the present invention provides a method of producing a fusion protein that comprises culturing a host cell comprising a nucleic acid that encodes any of the fusion proteins described in the present invention under one condition which produces the fusion protein, and the recovery of the fusion protein produced by means of the host cell. In one embodiment, the fusion protein is recovered from the cell culture medium and purified. In another embodiment, the host cell is a mammalian cell or a yeast cell. In either embodiment of the present invention, the fusion protein is recovered in a dimer. In any of the embodiments of this invention, the fusion protein is recovered from a partially cleaved fusion protein, as described in the present invention.
[0018] [0018] In another aspect, the present invention provides a method
[0019] [0019] In a further aspect, the present invention provides a kit that comprises any of the fusion proteins described in the present invention. In one embodiment, the fusion protein comprises a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a half-life domain, where the fusion protein inhibits activation complement and the VEGF signaling pathway (for example, inhibition of VEGF activity). In one embodiment, the fusion protein comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or an amino acid sequence having at least 90% identity to the sequence of amino acids selected from the group consisting of SEQ ID NO: 12, 33 to 37 and 40 in one embodiment, the kit also includes an information leaflet that includes instructions for using the fusion protein for treatment an inflammatory disease, an autoimmune disease, an eye disease or cancer in an individual.
[0020] [0020] It is to be understood that one, some, or all of the properties of the different modalities described in the present invention can be combined to form other modalities of the present invention. These and other aspects of the present invention will be apparent to a person skilled in the art. BRIEF DESCRIPTION OF THE DRAWINGS
[0021] [0021] Figure 1 shows the schematic drawings of the fusion proteins. A) anti-complement proteins (ACPs), ACP-1 and ACP-10. CID-WT is human CR1 SCR1 -3 of the wild type; CID - KN is a variant of human CR1 SCR1 - 3 N29K / D109N; ICD - YD is a variant of human CR1 SCR1-3 S37Y / G79D; CID - KYDN is human variant CR1 SCR1-3 N29K / S37Y / G79D / D109N, CID -NT is human CR1 SCR8 -10 of the wild type; and Fc, the Fc region of human I9G1. B) Bispecific anti-complementary proteins / VEGF (ACVPs), ACVP - 1 for ACVP - 6. CID is a variant of human CR1 SCR1- 3 N29K / S37Y / G79D / D109N; VID is the fusion of the Ig 2 type domain of VEGFR1 and the lg 3 type domain of VEGFR2; eFc, the Fc region of human IgG1.
[0022] [0022] Figure 2 shows the SDS - PAGE gels from purified fusion proteins. A) The purified ACP - 10 fusion proteins
[0023] [0023] Figure 3 is a series of graphs that demonstrate the inhibition of the complement pathway through the fusion of ACP proteins. A) Inhibition of the classical complement pathway in sheep erythrocytes sensitized with antibodies of various concentrations of fusion proteins ACP - 6, ACP -7, ACP - 9 € ACP - 10. B) Inhibition of the alternative pathway of complement in rabbit erythrocytes using various concentrations of ACP -6, ACP -7, ACP -9 and ACP - fusion proteins
[0024] [0024] Figure 4 is a series of graphs that demonstrate the in vitro binding of a VEGF by means of the fusion proteins as detected by ELISA. A) direct in vitro binding of VEGF mobilized by ACVP - 1. B) In vitro binding of soluble VEGF by ACVP - 1. CJ) In vitro binding of VEGF by ACVP -1, VID, or Avastin.
[0025] [0025] Figure 5 is a series of graphs that demonstrate the inhibition of the complement pathway by fusing ACVPs proteins. A) Inhibition of the classical complement pathway in sheep erythrocytes sensitized with antibodies of various concentrations of fusion protein ACVP - 1. B) Inhibition of the alternative pathway of complement in rabbit erythrocytes through the various concentrations of fusion protein ACVP - 1. Fc Log [nM] is the log concentration of the indicated fusion protein (nM).
[0026] [0026] Figure 6 is a graph showing the inhibition of VEGF-induced proliferation of human umbilical vein endothelial cells (HUVECs) by, VID, or CID ACVP fusion proteins - 1. All assays were performed in triplicate. ** p <0.01 when compared to the DMEM + VEGF control.
[0027] [0027] Figure 7 is a western blot that demonstrates the inhibition of activation of the VEGFR2 pathway by means of fusion proteins ACVP - 1, VID, or CID.
[0028] [0028] Figure 8 is a series of photographs of eyes from a laser-induced CNV monkey model. Twenty-one days after the 532 nm diode laser photo coagulation was delivered around the stain, the monkeys were injected intra-vitreally with a) a control vehicle (PBS); B) ACVP - 1; C) VID; or D) ICD at the indicated concentrations and photographs of the treated eye were taken 14 days after the dose, to measure leakage. DETAILED DESCRIPTION
[0029] [0029] The present invention provides, inter alia, fusion proteins, and their compositions, which inhibit the complement pathway and the vascular endothelial growth factor (VEGF) pathway. A fusion protein of the present invention, as described in the present invention comprises a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a half-life domain, in which the fusion protein inhibits complement activation and the VEGF signaling pathway (eg, inhibition of VEGF activity). Also described in the present invention are methods of producing fusion proteins and methods of using fusion proteins in the treatment of autoimmune diseases, complement-related diseases, inflammatory diseases, eye diseases, and / or cancer. |. General techniques
[0030] [0030] The techniques and procedures described or mentioned are generally well understood and commonly employed using conventional methodology through people who are well versed in the technique, such as, for example, the methodologies widely used
[0031] [0031] An "isolated" molecule (eg nucleic acid or protein) or cells is one that has been identified and separated and / or recovered
[0032] [0032] As used in the present invention, "substantially pure" refers to material that is at least 50% pure (i.e., contaminant elements), more preferably at least 90% pure, more preferably at least 95% pure, more preferably at least 98% pure, more preferably at least 99% pure.
[0033] [0033] A "fusion polypeptide" or "fusion protein" (used in the present invention interchangeably) refers to a polypeptide that has two or more covalently linked portions, together, each of which is derived from proteins many different. The two or more moieties can be linked directly through a single peptide bond or through a peptide linker that contains one or more amino acid residues. Generally, the two portions and the linker will be in the reading frame with each other and are produced using recombinant techniques.
[0034] [0034] The "percentage (%) of amino acids or nucleotides of sequence identity", with respect to a reference polypeptide, or nucleic acid sequence which is defined as the percentage of amino acid or nucleotide residues in a candidate sequence that are identical to the amino acid or nucleotide residues in the reference polypeptide or nucleic acid sequence, after aligning the sequences and introducing openings, if necessary, to achieve the maximum percentage of sequence identity , and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining the percentage of amino acid or nucleic acid sequence identity can be achieved through various ways that are within the knowledge of those skilled in the art, for example, using the computer programs available.
[0035] [0035] The term "vector", as used in the present invention, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is attached. The term includes the vector, such as a self-replicating nucleic acid structure, as well as the vector.
[0036] [0036] The terms "host cell", "host cell line", and "host cell culture" are used interchangeably and refer to cells in which exogenous nucleic acid has been introduced, including the progeny of these cells. Host cells include "transformants" and "transformed cells" which include the transformed primary cell and offspring derived therefrom, regardless of the number of passages. The offspring may not be entirely identical in nucleic acid content to a parent cell, but they may contain mutations. Mutant offspring that have the same biological function or activity as the one screened or selected in the originally transformed cell is included in the present invention.
[0037] [0037] As used in the present invention, "treatment" or "treating" is an approach to obtain beneficial or desired results, including and preferably the clinical results. For the purposes of this invention, the beneficial or desired clinical results include, but are not limited to, one or more of the following: to decrease the symptoms resulting from the disease, to increase the quality of life of those suffering from disease, decreasing the dose of other medications necessary to treat the disease, slowing the progression of the disease, and / or prolonging the survival of individuals.
[0038] [0038] As used in the present invention, "delaying the development of a disease" means to postpone, prevent, slow down, delay, stabilize and / or postpone the development of the disease (such as cancer). This delay can be of different lengths of time, depending on the natural history of the disease and / or the individual to be treated. As is evident to a person who is knowledgeable in the technique, a sufficient or significant delay can, in effect, include prevention, in which the individual does not develop the disease.
[0039] [0039] An "individual" or "subject" is a mammal. Mammals include, but are not limited to, domestic animals (for example, cows, sheep, cats, dogs and horses), primates (for example, humans and non-human primates, such as monkeys, rabbits), and rodents (for example, rats and mice). In some modalities, the individual or subject is a human being.
[0040] [0040] The term "pharmaceutical formulation" refers to a preparation that is such as to allow the biological activity of an active ingredient contained therein to be effective, and that it does not contain any additional components that are unacceptably toxic to the individual to whom the formulation is to be administered.
[0041] [0041] A "pharmaceutically acceptable carrier" refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is not toxic to an individual. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservatives.
[0042] [0042] An "effective amount or dose" of an agent, for example, a pharmaceutical formulation, refers to an effective amount, in dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result. An effective dosage can be administered in one or more administrations. For the purposes of this invention, an effective dose of the drug, compound, or pharmaceutical composition is an amount sufficient to carry out prophylactic or therapeutic treatment, either directly or indirectly. As understood in the clinical context, an effective dosage of a drug composition, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition. In this way, an "effective amount or dose" can be considered in the context of administering one or more therapeutic agents, and a single agent can be considered to be administered in an effective amount if, in conjunction with one or more other agents, a result desirable can be or is achieved.
[0043] [0043] As used in the present invention, "in conjunction with" refers to the administration of one treatment modality in addition to another treatment modality. As such, "in conjunction with" refers to the administration of one treatment modality before, during or after the administration of the other treatment modality for the individual.
[0044] [0044] The term "package insert" is used to refer to instructions normally included in commercial therapeutic product packages, which contain information on the indications, use, dosage, administration, combination therapy, contraindications and / or warnings about the use of such therapeutic products.
[0045] [0045] As in the present invention and the appended claims, the singular forms "one," one "," a "and" o "include plural reference unless the context clearly indicates otherwise. reference to a "fusion protein" or "fusion polypeptide" is a reference from one of many fusion proteins or fusion polypeptides, such as molar quantities, and includes their equivalents known to those skilled in the art. technique, and so on.
[0046] [0046] Reference to "about" a value or parameter in the present invention includes (and describes) the modalities that are directed to that value or parameter per se. For example, the description referring to "about X" includes the description of "X".
[0047] [0047] It is understood that modalities, aspects and variations of the present invention described in the present invention include "compound" and / or "consisting essentially of" modalities, aspects and variations. Ill. Fusion proteins
[0048] [0048] The present invention provides fusion proteins that inhibit activation of the complement pathway and the VEGF pathway. In some modalities, the complement pathway, which is inhibited by means of the fusion protein, can be the classical pathway of complement, the alternative pathway of complement, and / or the pathway of lectin. In some modalities, the VEGF pathway that is inhibited by means of fusion proteins is mediated by VEGF receptors, for example, VEGFR - 1, VEG-FR - 2, and VEGFR - 3. In some modalities, the VEGF pathway that is inhibited by fusion proteins is mediated by VEGF-A VEGF - B, VEGF - C, VEGF - D and PIGF. In some embodiments, the fusion proteins described in the present invention inhibit complement activation and the VEGF signaling pathway (eg, inhibition of VEGF activity). The fusion proteins described in the present invention comprise a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a half-life extending the domain. Complement inhibition domain (ICD)
[0049] [0049] The present invention provides complement inhibition domains (CIDs) that can be a component of any fusion polypeptide described in the present invention. The ICD may comprise a polypeptide fragment of a complement regulating protein involved in the complement pathway, which includes the members of the complement activation regulators (RCA) and the complement control proteins (CCP). In some modalities
[0050] [0050] The ICD may comprise a portion of a complement regulatory protein, which binds to a component of the complement and inhibits complement activation. For example, human CR1 (allotype A) is a large glycoprotein (- 200 kD), which consists of an extracellular domain comprising 30 short consensus homologous (SCR) repeats, each ranging from 60 to 70 amino acids,
[0051] [0051] CIDs comprising at least one SCR of any of the complement regulatory proteins shown in the present invention are provided in the present invention. Unless explicitly mentioned in the present invention, SCRs are numbered sequentially from Terminal N to Terminal C of the complement regulatory protein. For example, human CR1 contains 30 SCRs that are numbered 1 to 30 with SCR1 at the N-terminus of the human CR1 protein and SCR30 at the C-terminus of the human CR1 protein. In some embodiments, the CID comprises SCR1 - 10 of CR1, such as the amino acid sequence of SEQ ID NO: 6. In other embodiments, the CID comprises SCR1 - 3 of CR1, such as the amino acid sequence of SEQ ID NO: 1. In still other embodiments, the CID comprises SCR8 - 10 of CR1, such as the amino acid sequence of SEQ ID NO: 5. In some modalities, the CID comprises SCR2 - 4 of DAF, such as the amino acid sequence of SEQ ID NO: 13. In other embodiments, the CID comprises SCR2 - 4 of MCP, as does the amino acid sequence of SEQ ID NO: 14. In still other embodiments, the CID comprises SCR1 - 4 of factor H. In some respects, Factor H SCR1 - 4, such as the amino acid sequence of SEQ ID NO: 15. In still other embodiments, the CID comprises C4BPA SCR1 - 3, as does the amino acid sequence of SEQ ID NO: : 16. In any aspect of this invention, an ICD may comprise an amino acid sequence selected from the group containing is SEQ ID NO: 1a6e13a16. Factor H SCR1 - 4 is a CID that specifically targets the alternative route, but not the classic route. Since the classic complement pathway is necessary for the clearance of the pathogen dependent antibody, the therapeutic applications of a fusion protein containing a CID comprising SCR1 Factor H - 4 that inhibits only the alternative pathway may be a fusion protein preferred to limit the potential side effect of serious infections.
[0052] [0052] The CIDs described in the present invention can be any peptide inhibitors or oligonucleotide inhibitors against factor B, or factor D, or Factor P, or C3 or C5. CIDs can also be any of the full-length antibody fragments or one of the variable antibody regions (VH or VK), or scFv antibodies derived from antibodies against factor B, or Factor D, or Factor P , or C3 or C5.
[0053] [0053] In some embodiments, the amino acid sequence variants of the CIDs provided in the present invention are contemplated. For example, it may be desirable to improve the affinity binding and / or other biological properties of a CID. Variants of the amino acid sequence of a CID can be prepared by introducing appropriate changes to the nucleotide sequence that codes for the CID, or by peptide synthesis. Such modifications include, for example, deletions and / or insertions and / or substitutions of residues within the ICD amino acid sequences. Any combination of elimination, insertion and substitution can be done to arrive at the final construct, provided that the final construct has the desired characteristics, for example, the connection to a complement component and inhibition of activation of the complement pathway. . In the present invention there are provided variants of a CID which is a component of any fusion proteins described in the present invention. In some embodiments, an ICD comprises an amino acid sequence having at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with an amino acid sequence selected from the group consisting of SEQ ID NOs: 1a 6 and 13 to 16.
[0054] [0054] In some respects, the variant CID comprises one or more substitutions in amino acid residues chosen from the group consisting of N29, S37, G79, and D109, in which the position of the amino acid residue is relative to SEQ ID NO: 1. In a particular mode, the CID variant comprises substitutions in amino acid residues N29 and D109, where the position of the amino acid residue is relative to SEQ ID NO: 1. In another particular modality, the variant CID comprises substitutions in amino acid residues S37 and G79, where the position of the amino acid residue is relative to SEQ ID NO: 1. In yet another particular embodiment, the variant CID comprises substitutions in amino acid residues N29 , S37, G79, and D109, where the position of the amino acid residue is relative to SEQ ID NO: 1. In some embodiments, the CID variant comprises substitutions in amino acid residues N29K, S37Y, G79D, and D109N, where the position of the amino acid residue is relative to SEQ ID NO: 1. In some respects, the CID variant comprises substitutions for any of the amino acid positions in relation to SEQ ID NO: 1, as shown in Table 1.
[0055] [0055] The present invention provides VEGF inhibition domains (VIDs) that can be a component of any fusion protein described in the present invention. The human VEGF gene family contains five members: VEGF-A VEGF - B, VEGF - C, VEGF - D and the placental growth factor (PIGF). In addition, various isoforms of VEGF-A, VEGF - B and PIGF are generated through alternative RNA slicing (Sullivan LA, et al., (2010), MAb, 2 (2): 165 to 75) . All members of the VEGF family stimulate cellular responses by binding to VEGF cell surface receptors (VEGFR). For example, VEGF-A has been shown to stimulate endothelial cell mytogenesis, promoting cell survival and proliferation, inducing cell migration, and increasing microvascular permeability. VEGFR receptors are tyrosine kinase receptors that have extracellular regions that consist of 7 immunoglobulin-like (Ig) domains. VEGFR - 1 (FIt - 1), VEGF - A, - B, / and PIGF are switched on and can function as a VEGF bake receiver or VEGFR - 2 regulator. VEGFR - 2 ( KDR / FLK-1) binds to all VEGF isoforms and is the predominant mediator of VEGF-induced angiogenesis signaling). VEGFR - 3 (FIt - 4) binds VEGF - C and VEGF - D, but not VEGF - A, and functions as a mediator of lymphangiogenesis.
[0056] [0056] In any of the aspects of the present invention described in the present invention, a VID comprises a fragment of poly-
[0057] [0057] VID comprising at least one Ig-type domain of the two or more VEGFRs is contemplated in the present invention. In some embodiments, a VID comprises at least one Ig type from two or more VEGFRs selected from the group consisting of VEGFR - 1, VEGFR - 2, and VEGFR - 3. In some respects, a VID comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, but none more than 21 lg-type domains of at least two or more VEGFRs. In another aspect, a VID comprises 1 to 21, from 1st 20,1a19,1a18,1a17,1a16,1 to 15, 1a 14,1a13,1a12,1a11,1-10, 1-9, 1-8, 1 -7, 1-6, 1-5, 1-4, 1-3, or 1-2 lg-type domains of at least two or more VEGFRs.
[0058] [0058] The VIDs of the present invention can be any extracellular domain of VEGFR, dominate the negative forms of members of the VEGF family, antibodies against members of the VEGF family, antibodies against VEGFR, peptide inhibitors for members of the family of the VEGF or VEGFR, oligonucleotide inhibitors for members of the VEGF family or VEGFRs.
[0059] [0059] In some embodiments, amino acid sequence variants of any VIDs provided in the present invention are contemplated. For example, it may be desirable to improve the affinity and / or other biological properties of the VID binding. The amino acid sequence variants of a VID can be prepared by introducing appropriate changes to the nucleotide sequence encoding the VID, or by peptide synthesis. Such modifications include, for example, deletions and / or insertions and / or substitutions of residues within the VID amino acid sequences. Any combination of disposal, insertion and substitution can be done to arrive at the final construct, as long as the final construct can
[0060] [0060] The present invention provides a half-life domain that can be a component of any fusion protein described in the present invention. For example, the Fc regions of an immunoglobulin can be incorporated into a fusion polypeptide to increase half-life in vivo. A half-life extending domain may comprise an Fc region of any immunoglobulin of the isotype, subclass or allotype. In some modalities, the domain of extending half-life is an Fc region of an immunoglobulin of the isotype selected from the group consisting of IgG, IgA, 1gD, IgM and IgE. In some embodiments, the half-life extending domain comprises an immunoglobulin Fe region. In some respects, the Fc region is a human IgG1, IgG2, I9G3 or I19G4 human Fc. In some aspects, the Fc region is a human IgA1 or IgA 2 Fc. In some aspects, the Fc region is a human IgD Fc. In some respects, the Fc region is a human IgE Fc. In some respects, the Fc region is a human IgM Fc. In some respects, the Fe region is glycosylated. In some embodiments, the Fc region comprises the amino acid sequence selected from the group consisting of SEQ ID NOs:. 7, 39, 41, and 42 In any of the aspects provided in the present invention, the domain that extends half-life can be a polypeptide or its fragment selected from the group consisting of, but not limited to, a antibody, albumin, or a protease inhibitor (for example, alpha-1 - antitrypsin). In any of the aspects provided in the present invention
[0061] [0061] In some embodiments, the amino acid sequence variants of the domains that extend the half-life provided in the present invention are contemplated. For example, it may be desirable to improve the biological properties of the domain that extends half-life. Variants of the amino acid sequence of a domain that prolongs the half-life can be prepared by introducing appropriate changes in the nucleotide sequence that encodes the domain that prolongs the half-life, or by peptide synthesis. Such modifications include, for example, deletions and / or insertions and / or substitutions of residues within the amino acid sequences of the half - life domain. Any combination of elimination, insertion and substitution can be done to reach the final construct, as long as the final construct has the desired characteristics, for example, extending the half-life of the fusion protein. Variants of a half-life extension domain that may be a component of any fusion polypeptide described in the present invention are provided in the present invention. In some modes, the domain variant that extends the half-life is from a variant of the Fc region. Variants of the Fc region are known in the art, for example, US Patent Application Publication No. 2010/02493852, and US Patent Application Publication Number 2006/01341105, which are incorporated into the present invention by reference in its wholeness. In some embodiments, one or more amino acid modifications can be introduced into the Fc region of a fusion polypeptide in the provided invention, thereby generating a variant Fc region. The Fc region variant may comprise a human Fc region sequence (for example, a human IgG1, IgG2, IgG3 or IgG4 Fc region) that comprises an amino acid change (for example, a substitution) in one or more amino acid positions. In some embodiments, the Fc region comprises an amino acid sequence of at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% of sequence identity with a amino acid sequence selected from the group consisting of SEQ ID NO:. 7, 39, 41, and 42 In some modalities, the Fc region variant is glycosylated.
[0062] [0062] The present invention provides a linker that can be a component of any fusion protein described in the present invention. For example, flexible short peptides can be used between the domains (for example, ICD, VID, and domain that prolongs the half-life) of the fused polypeptide to ensure correct folding of each domain and to minimize impediment steric. In some embodiments, the linker is a peptide linker. In some embodiments, the linker is a peptide made up of amino acids selected from the group consisting of glycine, alanine and serine.
[0063] [0063] As described in the present invention, fusion proteins are polypeptides that have binding specificities for two different target binding partners. In some embodiments, the fusion polypeptides are human polypeptides. In some embodiments, fusion polypeptides comprise a first binding specificity to a component of the complement pathway (for example, C3b, C4b, iC3b, C3dg, C1qg or MBP) and a second binding specificity to a VEGF (for example, VEGF-A VEGF - B, VEGF - C, VEGF - D, or PIGF). In some embodiments, the fusion polypeptide comprises a first binding specificity to a mammalian component (eg, human) of the complement pathway and a second binding specificity to one (for example, human) Mammalian VEGF. In some embodiments, the fusion polypeptides bind to the same component of the complement pathway as any of the complement regulatory proteins described in the present invention. In some embodiments, the fusion polypeptides bind to the same component of the complement pathway, as any of CR1, Factor H, DAF, MCP, or C4BP. In some embodiments, the fusion polypeptides comprise at least one CID of any of the CIDs described in the present invention. In some respects, a fusion polypeptide comprises a CID that comprises the amino acid sequence selected from the group consisting of SEQ ID NOs: 1a 6 and 13a 16. In some embodiments, the fusion polypeptides bind to the same component of the VEGF pathway as any of those described in the present VEGFR invention.
[0064] [0064] In another aspect, the present invention provides a fusion polypeptide comprising: a) a CID comprising the amino acid sequence of QCNAPEWLPFARPTNLTDEFEFPIGTYLKYECRPGYYGRPFSIICLKN SVWTGAKDRCRRKSCRNPPDPVNGMVHVIKDIQFGSQIKYSCTKGY RLIGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNRENF HYGSVVTYRCNPGSGGRKVFELVGE-
[0065] [0065] Fusion polypeptides comprising a CID, a VID and a domain that extends half - life in any order are provided in the present invention. For example, a fusion polypeptide can comprise a CID, a VID, and an Fc (Fc) region from Terminal N to Terminal C, in an order selected from the group consisting of (1) VID, Fc , CID; (2) CID, Fc, VID; (3) CID, VID, Fc; (4) VID, CID, Fc; (5) Fc, VID, CID; and (6) Fc, CID, VID. In some embodiments, the fusion polypeptide comprises a CID, a VID, and Fc from Terminal N to Terminal C, in an order of VID, Fc, CID. In some embodiments, the fusion polypeptide comprises the amino acid sequence of:
[0066] [0066] GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFP LDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTH RQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSK HQHKKLVNRDLKTASGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGL MTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQODWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQ KSLSLSPGKGGGGGGQCNAPEWLPFARPTNLTDEFEFPIGTYLKYE CRPGYYGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVI KDIQFGSQIKYSCTKGYRLIGSSSATCIISGNTVIWDNETPICDRIPCGL
[0067] [0067] In other embodiments, the fusion polypeptide comprises the amino acid sequence of: QCNAPEWLPFARPTNLTDEFEFPIGTYLKYECRPGYYGRPFSIICLKN SVWTGAKDRCRRKSCRNPPDPVNGMVHVIKDIQFGSQIKYSCTKGY RLIGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNRENF HYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQ CIGGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQODWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGKGGGGGGGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLK KFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNY
[0068] [0068] In yet another embodiment, the fusion polypeptide comprises the amino acid sequence of: QCNAPEWLPFARPTNLTDEFEFPIGTYLKYECRPGYYGRPFSIICLKN SVWTGAKDRCRRKSCRNPPDPVNGMVHVIKDIQFGSQIKYSCTKGY RLIGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNRENF HYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQ CIGGGGGGGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKF PLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLT HRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSS KHQHKKLVNRDLKTASGSEMKKFLSTLTIDGVTRSDQGLYTCAASSG LMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQODWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
[0069] [0069] In still other embodiments, the fusion polypeptide comprises the amino acid sequence of: GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDG KRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIID VVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKL VNRDLKTAOSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNS TFVRVHEKGGGGGGQCNAPEWLPFARPTNLTDEFEFPIGTYLKYEC RPGYYGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIK DIQFGSQIKYSCTKGYRLIGSSSATCIISGNTVIWDNETPICDRIPCGLP PTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTS NDDQVGIWSGPAPQCIGGGGGGDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS
[0070] [0070] In other embodiments, the fusion polypeptide comprises the amino acid sequence of: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGGGG GGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHROQTNTII DVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKK LVNRDLKTOSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKN STFVRVHEKGGGGGGQCNAPEWLPFARPTNLTDEFEFPIGTYLKYE CRPGYYGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVI KDIQFGSQIKYSCTKGYRLIGSSSATCIISGNTVIWDNETPICDRIPCGL
[0071] [0071] In other embodiments, the fusion polypeptide comprises the amino acid sequence of: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGGGG GQCNAPEWLPFARPTNLTDEFEFPIGTYLKYECRPGYYGRPFSIICLK NSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKDIQFGSQIKYSCTKG YRLIGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNREN FHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAP QCIGGGGGGGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKK FPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYL THRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPS
[0072] [0072] In still other embodiments, the fusion polypeptide comprises the amino acid sequence of: DTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIP DGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTI IDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKK LVNRDLKTOSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKN STFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP
[0073] [0073] Fusion proteins comprising at least two or more CIDs, two or more VIDs, and / or two or more domains extending the half-life are also contemplated. For example, a fusion protein can include two CIDs, a VID, and an Fc region from Terminal N to Terminal C, in an order of VID, Fc, CID, CID, or any other combination of these. In one embodiment, the fusion protein may comprise a CID, two VIDs, and an Fc region from Terminal N to Terminal C, in an order of VID, VID, Fc, CID, or any other combination thereof. In another embodiment, the fusion protein may comprise a CID, a VID, and two Fc regions from Terminal N to Terminal C, in an order of VID, Fc, CID, Fc or any other combination thereof. In yet another embodiment, the fusion protein may comprise at least two CIDs, at least two VIDs, and at least two Fc regions from Terminal N to Terminal C, in an order of VID, Fc, VID , Fc, CID, or CID any other combination of these. Any combination of at least one VID, at least one CID, and at least one domain that extends half-life is provided in the present invention as if each combination had been expressly mentioned in this document.
[0074] [0074] The fusion proteins described in the present invention may comprise chemically modified forms of CIDs. For example, CIDs can be PEGylated or conjugated to polymers to increase half-life in vivo; or the CIDs can be chemically cross-linked to antibodies, antibody fragments, Fe regions, HSA, or other human proteins to increase the half-life in vivo; or ICDs can be formulated in any long-term, sustained release format to prolong anti-complement activity in vivo.
[0075] [0075] The fusion proteins described in the present invention may comprise chemically modified forms of VIDs. For example, VIDs can be PEGylated or conjugated to polymers to increase half-life in vivo; or VIDs can be chemically cross-linked with antibodies, antibody fragments, Fe regions, HSA, or other human proteins to increase half-life in vivo; or VIDs can be formulated in any long-term sustained release format to prolong anti-complement activity in vivo.
[0076] [0076] The fusion proteins described in the present invention may comprise chemically modified forms of CIDs and VIDs. For example, CIDs and VIDs can be PEGylated or conjugated with polymers to increase half-life in vivo; or CIDs and VIDs can be chemically crosslinked to antibodies, antibody fragments, Fe regions, HSA, or other human proteins to increase the half - life in vivo; or CIDs and VIDs could be formulated in any long-term sustained release format to prolong anti-complement activity in vivo.
[0077] [0077] In some embodiments, the amino acid sequence variants of the fusion proteins provided in the present invention are contemplated. For example, it may be desirable to improve the affinity and / or other biological properties of the CID, binding VID, and / or the domain that extends half-life. The amino acid sequence variants of the fusion polypeptide can be prepared by introducing appropriate changes in the nucleotide sequence that codes for the CID, VID and / or domain that prolongs the half - life, or by peptide synthesis. Such modifications include, for example, deletions and / or insertions and / or substitutions of residues within the amino acid sequences of the CID, VID and / or domain that prolongs the half-life. Any combination of elimination, insertion and substitution can be done to reach the final construct, provided that the final construct has the desired characteristics (for example, connection to a complement component, connection of a VEGF, inhibiting the complement pathway activation, inhibition of VEGF pathway activation and / or prolonged half-life). In some embodiments, the fusion polypeptide comprises at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92% at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% sequence identity with the amino acid sequence of a fusion polypeptide comprising the entire CID, VID, and Fc, as in the present invention described from Terminal N to Terminal C, in an order selected from the group consisting of (1) VID, Fc, CID; (2) CID, Fc, VID; (3) CID, VID, Fc; (4) VID, CID, Fc; (5) Fc, VID, CID; and (6) Fc, CID, VID. In some embodiments, the fusion polypeptide variant comprises at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least - at 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the selected amino acid sequence - nothing from the group consisting of SEQ ID NOs: 12.33 to 37, and
[0078] [0078] The amino acid residue substitutions described in the present invention also include conservative substitutions. Conservative substitutions are shown in Table 2 below, under the heading "preferred substitutions". If such substitutions result in a change in biological activity, then the most substantial changes, called "Exemplary Substitutions" in Table 2, or as best described below in reference to the classes of amino acids, can be introduced and the products are tracked. - ados. Amino acid substitutions as shown in Table 2, or as described below with reference to the classes of amino acids can be introduced into any of the fusion polypeptides or fragments thereof (for example, ICD, VID, domain that extends to half - life, etc.) provided in the present invention.
[0079] [0079] Substantial changes in the biological properties of proteins or polypeptides are carried out by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide skeleton in the substitution area, for example, as a helical sheet or conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the volume of the side chain. Amino acids can be grouped according to common side chain properties: (1) hydrophobic: norleucine, Met, Ala, Val, Leu, lle;
[0080] [0080] Non - conservative substitutions will imply the exchange of a member of one of these classes for another class.
[0081] [0081] A useful method for identifying certain residues or regions of the fusion protein, which are preferred locations for mutagenesis is called "alanine scanning mutagenesis" as described by Cunningham and Wells in Science, 244: 1081 1085 (1989). In the present invention, a target residue or group of residues is identified (for example, residues, such as arg, asp, his, lys, and charged glu) and replaced with a neutral or negatively charged amino acid (more preferably alanine or polyalea) - nina) to affect the interaction of amino acids with the target binding partner. Those amino acid sites that demonstrate functional sensitivity to substitutions are then refined by introducing more or other variants at, or for, the substitution sites. Thus, although the location for introducing a variation in the amino acid sequence is predetermined, the nature of the mutation per se does not need to be predetermined. For example, to analyze the performance of a mutation at a given location, wing scan or random mutagenesis is conducted at the codon or target region and the expressed fusion polypeptide variants are screened for the desired activity.
[0082] [0082] Any cysteine residue not involved in maintaining the proper conformation of the fusion polypeptides or fragments thereof (for example, ICD, VID, domain that extends half - life, etc.) can also be replaced, usually with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. On the other hand, cysteine binding (s) can be added to the fusion polypeptides or fragments thereof (for example, ICD, VID, domain that extends half-life, etc.), to improve their stability.
[0083] [0083] In other embodiments, the peptides or polypeptides of the present invention can comprise one or more amino acids that do not occur naturally or are modified. A "non-naturally occurring amino acid residue" refers to a residue, except for the aforementioned amino acid residues, which is capable of covalently bonding to the adjacent amino acid residue (s) ( s) in a naturally occurring polypeptide chain. Unnatural amino acids include, but are not limited to, homo - lysine, homo - arginine, homo - serine, azetidinecarboxylic acid, 2 - aminoadipic acid, 3 - aminoadipic acid, beta - alanine, propionic acid, 2 - aminobutyric acid, 4 - aminobutyric acid, 6 - aminocaproic acid, 2-aminoheptanoic acid, 2 aminoisobutyric acid, 3 - aminoisbutyric acid, 2 - aminopimelic acid, tert-butylglycine, 2,4-diaminoisobutyric acid, desmosine, 2 , 2 '- diaminopimélico, 2, 3 - diaminopropionic acid, N - ethylglycine, N - ethylasparagine, homoproline, hydroxylsine, allohydroxylysine, 3 - hydroxyproline, 4 - hydroxyproline, iso-desmosine, allo-isoleucine, N - methylalanine, N - methylalanine, N - methylglycine, N - methylisoleucine, N - methylpentylglycine, N - methylvaline, naphthalanine, norvaline, norleucine, ornithine, citrulline, pentylglycine, pipecolic acid and thioproline. Modified amino acids include natural and unnatural amino acids that are chemically blocked, reversibly or irreversibly, or modified in their Terminal N amino group or its side chain groups, for example, amino acids D and L
[0084] [0084] The insertions in the amino acid sequence include the a-amino - ("N") and / or carboxy - ("C") terminals ranging in length from one residue to polypeptides containing a hundred or more of residues, as well as intra-sequence insertions of one or multiple amino acid residues. Examples of terminal insertions include a fusion polypeptide with an N-terminal methionyl residue or the fusion polypeptide, fused with a cytotoxic polypeptide. Other variants of insertion of the fusion polypeptide molecule that include fusion to the N or C Terminal of the fusion polypeptide with an enzyme or polypeptide that increases the serum half-life of the fusion polypeptide (for example, half-length domain - life)
[0085] [0085] The present invention provides a signal peptide, which can be a component of any fusion polypeptides provided in the present invention. For example, a fusion polypeptide comprising a CID, a VID, and a half-life domain can further comprise a heterologous polypeptide, preferably a signal sequence or other polypeptide having a specific cleavage site at the Terminal N of the protein or polypeptide
[0086] [0086] The present invention provides a dimeric fusion protein comprising two fusion proteins, each fusion protein comprising any fusion protein described in the present invention. In one embodiment, the dimeric fusion protein comprises two identical fusion proteins. In another mode, the dimeric fusion protein comprises two different fusion proteins. In another embodiment, the dimeric fusion protein comprises at least one fusion protein comprising the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37 and 40, or an amino acid sequence
[0087] [0087] Isolated nucleic acids encoding any of the CIDs described in the present invention are provided in the present invention. In some embodiments, the CID comprises an amino acid sequence encoded by means of the nucleic acid sequence selected from the group consisting of SEQ ID NOS: 17 - 22 and 29-32. This description further provides an isolated nucleic acid molecule, wherein the nucleic acid molecule encoding a CID comprising an amino acid sequence of at least 85%, at least 86%, at least 87%, at least at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97% , at least 98%, at least 99%, or 100% sequence identity with the amino acid sequence selected from the group consisting of SEQ ID NOs: 1a 6 and 13 to 16. Also in the present invention are isolated nucleic acids which encode for any of the VIDs described in the present invention. In some embodiments, the VID comprises an amino acid sequence encoded by the nucleic acid sequence of
[0088] [0088] Polynucleotide sequences encoding any of the polypeptides described in the present invention (for example, CIDs, VIDs, domains that prolong half-life, ligands, fusion polypeptides, etc.) can be obtained using standard synthesis and / or recombinant techniques. The desired polynucleotide sequences can be isolated and sequenced from appropriate cells of origin. The source cells for the antibodies, peptides and / or polypeptides that include antibodies, peptides, and / or polypeptide-producing cells, such as hybridoma cells. Alternatively, polynucleotides can be synthesized using nucleotide synthesizers or PCR techniques. Vector
[0089] [0089] Once obtained, the sequences encoding the peptide, and / or polypeptide are inserted into a recombinant vector capable of replicating and expressing the heterologous polynucleotides in a host cell. Many vectors are available and known in the art that can be used for the purposes of the present invention. The selection of an appropriate vector will depend mainly on the size of the nucleic acids to be inserted into the vector and the particular host cell to be transformed with the vector. Each vector contains several components, depending on its function (amplification or expression of the polynu-
[0090] [0090] In some embodiments, the vector comprising a nucleic acid encoding an amino acid sequence of the fusion polypeptide further comprises a nucleic acid encoding a signal peptide. The nucleic acid encoding the signal peptide is bound by reading from the nucleic acid encoding the fusion polypeptide. In some respects, the vector comprising a nucleic acid encoding a fusion polypeptide further comprises a nucleic acid encoding a signal peptide comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:. 9, 10 and 43. In some respects, the vector comprises a nucleic acid encoding a fusion polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37, and 40 and a nucleic acid encoding a signal sequence comprising the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 10, or SEQ ID NO: 43. In some respects, the vector comprises a nucleic acid that encodes a fusion polypeptide comprising the amino acid sequence of SEQ ID NO: 12 and a nucleic acid encoding a signal sequence comprising the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 10, or SEQ ID NO: 43. In other aspects, the vector comprises a nucleic acid encoding a fusion polypeptide comprising the amino acid sequence of SEQ ID NO: 40 and a nucleic acid encoding a signal sequence comprising the amino acid sequence of SEQID NO: 9, SEQ ID NO: 10, or SEQ ID NO: 43. Vectors well known in the art, as well as the vectors described in the present invention (for example, pCl - neo), can be used to replicate and express the polynu-
[0091] [0091] In some embodiments, each cistron within a recombinant vector comprises a secretion signal sequence component that directs the translocation of the expressed polypeptides across a membrane. In general, the signal sequence can be a component of the vector, or it can be a part of the DNA of the target polypeptide that is inserted into the vector. The signal sequence selected for the purpose of the present invention must be one that is recognized and processed (that is, cleaved by a signal peptidase) through the host cell. For prokaryotic host cells that do not recognize and process the native signal sequences for heterologous polypeptides, the signal sequence is replaced by a sequence of prokaryotic signal selected, for example, from the group consisting of alkaline phosphatase , penicillinase, Ipp, or heat-stable enterotoxin leaders Il (STH), LamB, PHOE, PelB, OmpA and MBP. In some embodiments, the signal sequence is encoded using a nucleic acid selected from the group consisting of SEQ ID NOs: 25 and 26. (2) Origin of replication
[0092] [0092] Both expression and cloning vectors contain a nucleic acid sequence that allows the vector to replicate in one or more selected host cells. Generally, in cloning vectors this sequence is one that allows the vector to replicate independently of the host's chromosomal DNA, and includes the origins of replication or autonomous replication sequences. Such sequences are well known for a variety of bacteria,
[0093] [0093] Expression and cloning vectors may also contain a selection gene, known as a selectable marker capable of providing phenotypic selection in transformed cells. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, for example, ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) provide non-critical nutrients available from complex media, for example, D-alanine coding for the Bacillii gene. An example of a selection scheme uses a drug to stop the growth of a host cell. The cells that are successfully transformed with a heterologous gene produce a protein that confers resistance to the drug and thus survive the selection regime. Examples of such dominant selection strategies use neomycin, mycophenolic acid and hygromycin drugs. Another example of selectable markers suitable for mammalian cells are those that allow the identification of cells competent to take nucleic acids encoding fusion polypeptide or fusion polypeptide fragments, such as dihydrofolate reductase ("DHFR" ), glutamine-synthase (GS), thymidine kinase, metallothionein | and Il, preferably
[0094] [0094] For another example, E. coli is typically transformed using pBR322, a plasmid derived from an E. coli species. PBR322 contains genes that code for ampicillin (Amp) and tetracycline (Tet) and the resistance thus provides easy means for identifying transformed cells. PBR322, its derivatives, or other microbial or bacteriophage plasmids can also contain, or be modified to contain, promoters that can be used through the microbial organism to express endogenous proteins.
[0095] [0095] A suitable selection gene for use in yeast is the trp 1 gene present in the yeast plasmid YRp7 (Stincheomb et al .., Nature, 282: 39 (1979)). The trp1 gene provides a selection marker for a mutant strain of yeast without the ability to grow tryptophan containing medium (eg ATCC No. 44076 or PEP4 - 1). Jones, Genetics, 85: 12 (1977). The presence of the trp1 lesion in the yeast genome of the host cell then provides an effective environment for detecting transformation through growth in the absence of tryptophan. Similarly, Leu2-deficient yeast strains (for example, ATCC 20622 or 38626) can be complemented by plasmids known to carry the Leu2 gene. In addition, vectors derived from the circular plasmid of 1, mM pKD1 can be used for transformation of Kluyveromyces yeasts. Alternatively, an expression system for large-scale production of recombinant calf chymosin has been reported for K. lactis. Van den Berg, Bio / Technology, 8: 135 (1990). Stable multiple copy expression vectors for secreting mature recombinant human serum albumin by industrial Kluyveromyces strains have also been described. Fleer et al., Bio / Technology, 9: 968 to 975 (1991).
[0096] [0096] In addition, the phage vectors containing the replicon and control sequences that are compatible with the host microorganism can be used as transformation vectors in connection with these hosts. For example, from bacteriophages, such as AGEM.TM. -11 can be used to make a recombinant vector that can be used to transform susceptible host cells, such as E. coli LE392. (4) Promoter Component
[0097] [0097] Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the nucleic acid encoding the fusion polypeptides or fragments thereof (eg, CID, VID, domain extending the half - life, etc.). Promoters suitable for use with prokaryotic hosts include the phoA promoter, lactamase and lactose promoter systems, alkaline phosphatase promoter, a tryptophan promoter system, and hybrid promoters such as
[0098] [0098] Both constitutive and inducible promoters can be used in the present invention, according to the needs of a given situation, which can be determined through a person who is well versed in the technique. A large number of promoters recognized by a variety of potential host cells are well known. The selected promoter can be operatively linked to the DNA cistron encoding a polypeptide described in the present invention, by removing the promoter from the source DNA by digesting with restriction enzymes and inserting the isolated promoter sequence into the vector of choice. Both the native promoter sequence and many heterologous promoters can be used to direct the amplification and / or expression of target genes. However, heterologous promoters are preferred, as they generally allow for greater transcription and higher yields of the expressed target gene when compared to the native promoter of the target polypeptide.
[0099] [0099] Promoter sequences for eukaryotes are known. Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of the transcription of many genes is a CN-CAAT region where N can be any nucleotide. At the 3 'end of most eukaryotic genes is an AATAAA sequence which may be the signal for the addition of the polyA tail to the 3' end of the coding sequence. All of these sequences can be inserted into eukaryotic expression vectors.
[00100] Examples of promoter sequences suitable for use with yeast hosts include promoters for 3-phosphoglycerate kinase or other glycolytic enzymes, such as enola-, glyceraldehyde - 3-phosphate-dehydrogenase, hexokinase, pyruvate decarboxylase, phospho-fructokinase , glucose - 6 - phosphate isomerase, 3-phosphoglycerate-mutase, pyruvate-kinase, triosphosphateisomerase, phospholucose-isomerase and glucokinase.
[00101] [00101] Yeast-inducible promoters have the additional advantage of allowing controlled transcription through growth conditions. Exemplary inducible promoters include the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradation enzymes associated with the metabolism of nitrogen, metallothionein, glyceraldehyde - 3 - phosphate dehydrogenase, and enzymes responsible for the use of maltose and galactose. Vectors and promoters suitable for use in yeast expression are further described in EP 73657. Yeast enhancers are also used advantageously with yeast promoters.
[00102] [00102] The transcription of nucleic acids encoding the fusion polypeptides or fragments thereof (for example, CID, VID, half-life domain, etc.) from vectors in mammalian host cells can be controlled, for example, by promoters obtained from virus genomes, such as polyoma virus, bird poxvirus, adenovirus (such as Ade- novirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus , a retrovirus, hepatitis B virus and preferably Simian Virus 40 (SV40), by heterologous mammalian promoters, for example, the actin promoter or an immunoglobulin promoter, and by heat shock gene promoters, provided that such promoters are compatible with the desired host cell systems.
[00103] [00103] The early and late promoters of the SV40 virus are con-
[00104] [00104] The transcription of a DNA encoding the fusion polypeptides or fragments thereof (for example, ICD, VID, domain that extends half-life, etc.) through the upper eukaryotes is often increased through insertion of an enhancer sequence in the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a - fetoprotein and insulin). Typically, however, a person who is skilled in the art will use an enhancer for a eukaryotic virus. Examples include the SV40 enhancer on the late side of the origin of replication (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the origin of replication, and adenovirus enhancers. See also Yaniv, Nature 297: 17 to 18 (1982) on reinforcing elements for activation of eukaryotic promoters. The enhancer can be joined to the vector in a 5 'or 3' position for the protein coding sequences - fusion or fusion protein fragment, but is preferably located at a 5 'location of the promoter. (6) Transcription termination component
[00105] [00105] The expression vectors used in eukaryotic host cells (from yeast, fungi, insects, plants, animals, humans, or nucleated cells from other multicellular organisms) will also contain the sequences necessary for the termination of transcription and for the stabilization of MRNA. Such sequences are commonly available from the 5 'end and, occasionally 3', untranslated regions of eukaryotic or viral DNA or CDNA. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the MRNA that co-complicates the antibodies or fragments thereof. A useful transcription termination component is the polyadenylation region of the bovine growth hormone. See WO94 / 11026 and the expression vector described thereafter. Host cells
[00106] [00106] Host cells suitable for cloning or expressing DNA encoding the fusion polypeptides or fragments thereof (eg, CID, VID, half-life domain, etc.), in the vectors described in the present invention include prokaryotes, yeast or higher eukaryotes from the cells described above. Prokaryotes suitable for this purpose include eu-bacteria, such as Gram - negative or Gram - positive organisms, for example, Enterobacteriaceae such as Escherichia, for example, E. coli, Enterobacter, Enwinia, Klebsiella, Proteus, Salmonella, for example - example, Salmonella typhimurium, Serratia, for example, Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis (for example, B. licheniformis 41P described in DD 266,710 published on 12 December April 1989), Pseudomonas such as P. aerugino-Sa, and Streptomyces. A preferred E. coli is the E. coli 294 cloning host (ATCC 31446), although other strains such as E. coli B, E. coli X1776 (ATCC 31,537), and E. coli W3110 (ATCC 27325) are also appropriate. These examples are illustrative rather than limiting.
[00107] [00107] Fusion polypeptides or fragments thereof (for example, ICD, VID, domain that extends half-life, etc.) can be produced in bacteria, in particular, when glycosylation is not necessary, as such as when the fusion polypeptides or fragments thereof (for example, CID, VID, half-life domain, etc.) are conjugated to a cytotoxic agent (for example, a toxin). E. coli production is faster and more efficient. For the expression of fusion polypeptides or fragments thereof (for example, CID, VID, domain that extends half-life, etc.) in bacteria, see, for example, US 5,648,237 (Carter et al.), US 5,789,199 (Joly et al ..) and US 5,840,523 (Simmons et al ..) which describes the translation initiation region (TIR), and the signal sequences to optimize expression and secretion. After expression, the fusion polypeptides or fragments thereof (for example, ICD, VID, half-life domain, etc.) are isolated from the E. coli cell paste in a soluble fraction and can be purified by, for example, a protein from column A or G, depending on the binding portion of the fusion polypeptide, such as the Fc isotype region. Final purification can be carried out by the same process used to purify the fusion polypeptides or fragments thereof (for example, CID, VID, half-life domain, etc.), expressed, for example, in cells CHO.
[00108] [00108] In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeasts are also suitable cloning or expression hosts for fusion polypeptides or fragments thereof (for example, ICD, VID, domain that extends half - life, etc.) coding vectors. Saccharomyces cerevi-
[00109] [00109] Certain fungi and yeast strains can be selected in which the glycosylation pathways have been "humanized", resulting in the production of fusion polypeptides or fragments of them (for example, CID, VID, domain that extends half-life, etc.) with a partially or fully human glycosylation pattern. See, for example, Li et al .., Nat. Biotech. 24: 210 to 215 (2006) (which describes the humanization of the glycosylation pathway in Pichia pastoris); and Gerngross et al .. supra.
[00110] [00110] Host cells suitable for the expression of glycosylated fusion polypeptides or fragments thereof (for example, ICD, VID, half-life domain, etc.) are derived from multicellular organisms. Examples of invertebrate cells include insect and plant cells. Numerous baculovirus strains and variants and corresponding permissive insect host cells have been identified - from hosts such as
[00111] [00111] Plant cell cultures of cotton, corn, potatoes, soy, petunia, tomatoes, and tobacco can also be used as hosts.
[00112] [00112] However, interest has been greater in vertebrate cells and the propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are the monkey kidney CV1 strain transformed by SV40 (COS - 7, ATCC CRL 1651); the human embryonic kidney lineage (cells 293 or 293 subcloned for growth in suspension culture, Graham et al., J. Gen. Virol 36: 59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells / - DHFR (CHO, Urlaub et al., Proc Nati Acad Sci U.S. 77: 4216 (1980)); (23: 243 to 251 (1980) TM4, Mather, Biol Reprod.). mouse Sertoli cells; monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO - 76, ATCC CRL -1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (3A BRL, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mammary tumor of rat (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals NY Acad Sci 383: 44-68 (1982)); MRC 5 cells; Cells
[00113] [00113] Examples of mammalian cells capable of expressing any of the proteins described in the present invention can be selected from the group consisting of a hamster cell, a mouse cell, a mouse cell, a rabbit, cat cell, dog cell, bovine cell, goat cell, porcine cell, equine cell, sheep cell, monkey cell, chimpanzee cell, and cell human. In another embodiment, the cell is a cell of neural animals (such as, but not limited to, a cell of the peripheral nervous system or a cell of the central nervous system), a muscle cell (such as a muscle cell cardiac, skeletal or smooth), a gamete (such as a sperm or oocyte cell), a cancer cell, an immune cell (such as, but not limited to, a macrophage, a T cell or a - B cell ), a stem cell (such as, but not limited to, an embryonic cell or adult stem cell), or an endocrine cell (such as, but not limited to, a thyroid cell , a hypothalamic cell, a pituitary cell, an adrenal cell, a testicular cell, an ovarian cell, a pancreatic cell (such as a B cell), a stomach cell, or an intestinal cell). In some embodiments, the cell is a human cell in cell culture. In some embodiments, the cell is a non-human cell in cell culture. In some embodiments, the cell is a cancer cell.
[00114] [00114] Host cells are transformed or transfected with the expression of the cloning vectors described above or of fusion polypeptides or fragments thereof (for example, ICD, VID, half-life domain, etc.) production and cultivated in conventional nutrient media modified as appropriate to induce promoters, select transformants, or amplify the genes encoding the desired sequences.
[00115] [00115] Transfection refers to the incorporation of an expression vector by means of a host cell or not by any coding sequences actually expressed. Numerous transfection methods are known to the person skilled in the art, for example, electroporation and CaPO4 precipitation. Successful transfection is generally recognized when any indication of the operation of this vector occurs within the host cell.
[00116] [00116] Transformation means the introduction of DNA into the prokaryotic host so that the DNA is replicable, either as an extrachromosomal element or as a chromosome member. Depending on the host cell used, transformation is done using standard techniques appropriate for such cells. Calcium treatment using calcium chloride is generally used for bacterial cells that contain substantial cell wall barriers. Another method for transformation employs polyethylene glycol! / DM- SO. Another technique that can be used is electroporation. V. Methods of producing fusion polypeptides and fragments thereof
[00117] [00117] Methods of producing fusion polypeptides or fragments thereof are provided in the present invention.
[00118] [00118] The prokaryotic cells used to produce the fusion polypeptides or fragments thereof (e.g., ICD, VID, half-life domain, etc.) of the present invention are grown in means known in the art and suitable for host culture selected cells. Examples of suitable media include Luria broth (LB) plus the necessary nutrient supplements. In preferred modalities, the media also contains a selection agent, chosen based on the expression vector construct, to selectively allow the growth of prokaryotic cells containing the expression vector. For example, ampicillin is added to the growth media for cells that express the ampicillin resistant gene. Any necessary supplements in addition to carbon, nitrogen and sources of inorganic phosphate can also be included in appropriate concentrations introduced.
[00119] [00119] The host cells used to produce the fusion polypeptides or fragments thereof (e.g., ICD, VID, half-life domain, etc.) described in the present invention can be grown in a variety of media . Commercially available media such as Ham's F10 (Sigma), Minimum Essential Medium ((MEM), Sigma), RPMI-1640 (Sigma), and Modified Eagle Dulcecco Medium ((DMEM), Sigma) are suitable for host cell culture. In addition, any of the means described in Ham et al .. Meth. Enz. 58: 44 (1979), Barnes et al .. Anal. Biochem.102: 255 (1980), U.S. Patent No. 4,767,704; 4657866; 4927762; 4560655; or 5,122,469; Publication of WIPO No. WO 90
[00120] [00120] When using recombinant techniques, the fusion polypeptides or fragments thereof (e.g., CID, VID, half-life domain, etc.) described in the present invention can be produced intracellularly, in space periphatic, or secreted directly into the medium. If polypeptides are produced intracellularly, as a first step, protein recovery typically involves disturbance of the microorganism, usually by means such as osmotic shock, ultrasound or lysis. Once the cells are disrupted, particulate residues from host cells or lysed fragments are removed, for example, by centrifugation or by ultrafiltration. Carter et al., Bio / Technology 10: 163 to 167 (1992)
[00121] [00121] Fusion polypeptides or fragments thereof (for example, ICD, VID, domain that extends half-life, etc.) of the compositions prepared from such cells can be purified using, for example, hydroxylapatite chromatography , gel electrophoresis, dialysis and affinity chromatography, with affinity chromatography being the preferred purification technique. In some modes, protein A or protein G is used as an affinity linker for use in affinity chromatography. The suitability of protein A as an affinity linker depends on the species and isotype of any immunoglobulin Fc region that is present in the fusion polypeptides or fragments thereof (Lindmark et al .., J. Inmunol. Meth. 62: 1 to 13 (1983) In a preferred embodiment, protein A is used as an affinity linker for the isolation and purification of fusion polypeptides or fragments thereof (for example, CID, VID, domain that extends half-life, etc.), as described in the present invention. In some modalities, protein G is used as an affinity binder for
[00122] [00122] “Following any preliminary purification step or steps, the mixture comprising the fusion polypeptide or fragments thereof (for example, ICD, VID, domain that extends half-life, etc.) of interest and contaminants can be subjected to hydrophobic interaction chromatography at low pH using an elution buffer at a pH between about 2.5-4.5, preferably carried out at low salt concentrations (for example, from about 0 to 0.25 M salt).
[00123] [00123] In general, the different methodologies for the preparation of fusion polypeptides or fragments thereof (for example,
[00124] [00124] Polypeptides can be purified and identified using generally known methods, such as fractionation in immunoaffinity or ion exchange columns; ethanol precipitation; Reverse phase HPLC; chromatography on silica or on a cation exchange resin such as DEAE; chromatofocusing; SDS - PAGE; precipitation with ammonium sulfate; gel filtration using, for example, Sephadex G - 75; hydrophobic affinity resins, affinity binder using a suitable binding partner immobilized on a matrix, ELISA, BIACore, Western blot assay, amino acid and nucleic acid sequencing, and biological activity.
[00125] [00125] The fusion proteins described in the present invention can be characterized or evaluated by means of biological activities, including, but not limited to, affinity to a target binding partner (for example, VEGF or complementary protein), competitive binding (for example, target partner blocking to complement regulatory protein or VEGFR), inhibitory activity (for example, inhibition of complement activation or VEGF activation), half-life or fusion protein, inhibition of cell proliferation, inhibition of tumor growth, and inhibition of angiogenesis (for example, choroidal neovascularization). In some embodiments, the fusion proteins described in the present invention
[00126] [00126] The fusion proteins described in the present invention can be evaluated by affinity to a binding partner, such as a complement protein (for example, C3b, C4b, iC3b, C3dg, C1q or MBP). Many methods for assessing binding affinity are known in the art and can be used to identify the binding affinities of fusion proteins with a binding partner. The binding affinities can be expressed as a dissociation constant (Kd) or values of semi-maximum effective concentration (EC50). The values of techniques for determining binding affinities (for example, Kd values) are well known in the art, such as Enzyme-Linked Immunosorbent Assay (ELISA), and BIAker. see Harlow and Lane, Antibodies: A Laboratory Manual, CSH Publications, New York (1988); Ausubel et al., Current Protocols in Molecular Biology, John Wiley & Sons, New York, (2009); Altschuh et al., Biochem, 31: 6298 (1992). ; and the BlAcore method described by Pharmacia Biosensor, all of which are incorporated into the present invention by reference. For example, the binding affinities of the fusion proteins with a binding partner can be determined using the ELISA method. In some embodiments, the binding of fusion proteins to C3b or C4b is assayed using ELISA. In this exemplary assay, the wells of a 96 well ELISA plate are coated with 100 ng / well of C3b or C4b. About 0-1 µM of purified fusion protein is added to each well and incubated for 1 hour before washing to remove uncoupled C3b or C4b. The dilution of an anti-Fc HRP conjugate (eg Sigma Catalog No. A0170 - 1 ml) 1: 5000 is subsequently
[00127] [00127] The fusion proteins described in the present invention can be evaluated for the inhibitory activity of a complement pathway (for example, classical pathway, the alternative pathway, and / or the lectin pathway). Many methods for assessing inhibitory activity are known in the art and can be used to identify the inhibitory activity of a fusion protein. Binding affinities can be expressed as half of the maximum effective concentration values
[00128] [00128] In any of the embodiments of this invention, a fusion protein has an EC50 of <1 µM, 100 nM £, <10 NM, 1 nM £, <0.1 nM, <0.01 nM , or <0.001 nM (eg 10-8 M or less, eg 10-8 M to 10-13 M, eg 10-9 M to 10-13 M) for inhibiting an activity (eg example, inhibition of complement activity and / or VEGF activity). In any of the embodiments of this invention, a fusion protein has a Kd for a binding partner (for example, complementing protein and / or VEGF) less than about any of about 1.0 mM, 500 µM , 100 µM, 50 µM, 25 µM, 10 µM, 5 MM, 1 µM, 900 nM, 800 nM, 700 nM, 600 nM, 500 nM, 400 nM, 350 nM, 300 nM, 250 nM, 200 nM, 150 nM, 100 nM, 95 nM, 90 nM, 85 nM, 80 nM, 75 nM, 70 nM, 65 nM, 60 NM, 55 nM, 50 nM, 45 nM, 40 nM, 35 nM, 30 nM, 25 nM, 20 nM, 15 NM, 10 nM, 5 nM, 1 nM, 900 pM, 800 pM, 700 pM, 600 pM, 500 pM, 400 pM, 300 pM, 200 pM, 100 pM, 50 pM, 25 pM, 12: 05, 18: 25, 17: 00, 16: OO, or 15: OO, inclusive, including any values between these numbers. In some embodiments, the fusion polypeptide variants described in the present invention bind to a binding partner with a higher affinity compared to the binding to a wild type fusion polypeptide described in the present invention. In some respects, the fusion polypeptide variant that binds to a binding partner with at least any of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 6000, 7000, 8000, 9000, or 10,000, affinity times, including, including any the value between these numbers, higher compared to the binding partner binding of a fusion polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NOs: 12, 33 to 37, and 40.
[00129] [00129] In some embodiments, the fusion proteins described in the present invention can be evaluated for anti-proliferative activity, such as reducing cell proliferation or tumor growth. Many methods for assessing the antiproliferative properties for a fusion protein are known in the art. in an exemplary assay, human umbilical vein endothelial cells (HUVEC) can be used to demonstrate inhibition of VEGF-dependent cell proliferation. In this assay, HUVEC cells are maintained in Endothelial Cell Growth Medium (for example, from Lonza, Inc.), with 2% FBS. About 50 mL of | nM of VEGF - A is added to the wells of a 96 well flat bottom microtiter plate coated with collagen and various concentrations of the fusion protein. About 50 µl of HUVECs in 1 x 105 cells / ml in medium - 199 (eg, Hyclone, Inc.) are added to each well and incubated for 72 hours at 37 ° C with 5% CO2. After incubation, cell proliferation is tested by adding 10 µl CCK - 8 (eg, Dojindo, Inc.) to each well and then measuring the absorption of OD at 450/650 nm, to determine the inhibition of cell proliferation by the fusion protein. In one example in the in vivo trial, tumor growth inhibition is assessed in mice with xenograft tumors derived from a certain type of cancer (eg hepatocellular carcinoma, colorectal cancer, etc.). various concentrations of the fusion protein are administered to the mice at a particular dosage regimen and tumor growth is measured at least twice over a period of time to determine inhibition of tumor growth by fusion protein. In some embodiments, the anti - angiogenic properties of a fusion protein are measured using techniques well known in the art.
[00130] [00130] The present invention provides methods for treating or preventing an inflammatory disease, autoimmune disease, complementary disease, eye disease, and cancer. In some embodiments, the present invention provides a method of treating an individual with an inflammatory disease, autoimmune disease, complement-related disease, eye disease, and / or cancer, which comprises administering to the individual an effective amount of any fusion protein described in the present invention. In some embodiments, the method further comprises administering to the individual an effective amount of at least one additional therapeutic agent, for example, as described below. In some embodiments, the present invention provides a fusion protein for use in inhibiting the binding of a complement protein to a complement regulatory protein. In some modalities,
[00131] [00131] An inflammatory disease that can be treated or prevented by the fusion proteins described in the present invention include, but are not limited to, macular degeneration (e.g., age-related macular degeneration), acute myocardial infarction (AMI), atherosclerosis, glomernephritis, asthma, and multiple sclerosis. An autoimmune disease that can be treated or prevented by the fusion proteins described in the present invention include, but are not limited to, Alzheimer's disease, autoimmune uveitis, systemic lupus erythematosus (SLE), lupus nephritis, ulcerative colitis , inflammatory bowel disease, Crohn's disease, adult breathing difficulty syndrome
[00132] [00132] In another aspect, the present invention provides for the use of a fusion protein in the production or preparation of a medicament. In some modalities, the medication is for the treatment of an inflammatory disease, autoimmune disease, complementary-related disease, eye disease, and cancer. In some embodiments, the present invention provides a fusion protein for the manufacture of a medicament for use in inhibiting the binding of a complement protein, with a complement regulating protein. In some embodiments, the present invention provides a fusion protein for the manufacture of a medicament for use in inhibiting the binding of a VEGF to a VEGFR. In some embodiments, the present invention provides a fusion protein for the manufacture of a medicament for use in inhibiting complement activation and the VEGF signaling pathway (eg, inhibiting VEGF activity) in an individual, which it comprises administering to the individual an effective amount of the fusion protein to inhibit complement activation and VEGF signaling pathway (e.g., inhibition of VEGF activity). An "individual", according to any of the above modalities, is preferably human.
[00133] [00133] The desired dosages and drug concentration of pharmaceutical compositions of the present invention may vary depending on the particular intended use. Determining the proper dosage or route of administration is well within the skill of a person who is skilled in the art. Animal experiments provide reliable guidance for determining effective doses for human therapy. Interspecies for effective dose escalation can be performed following the principles established by Mordenti, J. and Chappell, W. "The Use of Interspecies Scaling in Toxicokinetics" in Toxicokinetics and New Drug Development, Yacobi et al., Eds , Pergamon Press, New York
[00134] [00134] For the in vivo administration of the fusion polypeptides described in the present invention, normal dosage amounts can vary from about 10 ng / kg to about 100 mg / kg of an individual's body weight or more per day, preferably about 1 mg / kg / day to 10 mg / kg / day, depending on the route of administration. For repeated administrations over several days or more, depending on the severity of the disease or disorder being treated, treatment is continued until a desired suppression of symptoms occurs.
[00135] [00135] An exemplary dosage regimen comprises the administration of an initial dose of a fusion protein of about 2 mg 1 kg, followed by a weekly maintenance dose of about 1 mg / kg every two weeks. Other dosage regimens may be useful, depending on the pattern of pharmacokinetic decay that the doctor wants to achieve. For example, an individual's dosage 1-21 times per week is contemplated in the present invention. In certain embodiments, the dosage ranges from about 3 mg / kg to about 2 mg / kg (such as about 3 µg / kg, about 10 µg / kg, about 30 µg / kg, about 100 µg / kg) kg, about 300 ug / kg, about 1 mg / kg, and about 2 / mg / kg) can be used. In certain modalities, the frequency of administration is three times a day, twice a day, once a day, once every two days, once a week, once every two weeks, once every four weeks. , once every five weeks, once every six weeks, once every seven weeks, once every eight weeks, once every nine weeks, once every ten weeks, or once a month, once every two months, once every three months, or more. The progress of this therapy is easily monitored using conventional techniques and tests. The dosage regimen, including the administered fusion protein, may vary over time regardless of the dose used.
[00136] [00136] Dosages for a particular fusion protein, can be determined empirically, in individuals who have been administered one or more administrations of fusion protein. Individuals receive incremental doses of a fusion protein. To assess the effectiveness of a fusion protein, a clinical symptom of an inflammatory disease (for example, AMD) can be monitored.
[00137] [00137] The administration of a fusion protein according to the methods of the present invention can be continuous or intermittent, depending, for example, on the physiological condition of the recipient, whether the effect of administration in a therapeutic or prophylactic manner, and other factors known to qualified professionals. Administration of a fusion protein can be essentially continuous over a pre-selected period of time or it can be a series of spaced doses, for example, during or after the development of an inflammatory disease (for example, AMD).
[00138] [00138] Guidance on certain dosages and delivery methods is provided in the literature; see, for example, U.S. Patent No. 4,657,760; 5206344; or 5,225,212. It is within the scope of the present invention that different formulations will be effective for different treatments and different diseases or disorders, and that administration aimed at treating a specific organ or tissue may require delivery in a different than for another organ or tissue. In addition, dosages can be administered by one or more separate administrations, or by continuous infusion. For repeated administrations over several days or more, depending on the condition, treatment is continued until a desired suppression of the symptoms of the disease occurs. However, other dosage regimens can be useful. The progress of this therapy is easily monitored using conventional techniques and tests. Formulation administration
[00139] [00139] The fusion protein of the present invention (and any additional therapeutic people) can be administered by any suitable means, including parenteral, intrapulmonary and intranasal, and, if desired for local treatment, intralesional. Parenteral infusions include intramuscular, intravenous, intraarterial, intraperitoneal or subcutaneous administration. Dosing can be performed by any suitable route, for example, through injections, such as intravenous or subcutaneous injections, depending in part on whether the administration is brief or chronic. Various dosage schedules, including, but not limited to single or multiple administrations over various time points, bolus administration and pulse infusion are contemplated in the present invention. In some embodiments, the compositions are administered directly to the eye or eye tissue. In some embodiments, the compositions are administered topically to the eye, for example, in eye drops. In some embodiments, the compositions are administered by injection into the eye (intraocular injection) or to the tissues associated with the eye. The compositions can be administered, for example, through intraocular injection, periocular injection, sub-retinal injection, intratracheal injection, trans-septal injection, sub-scleral injection, intracoral injection, intracameral injection, subconjectival injection, injection subconjunctival, sub-Tenon injection, retrobulbar injection, peribulbar injection, or posterior juxtaescleral delivery. The compositions can also be administered, for example, to the vitreous, optic, aqueous humor, sclera, conjunctiva, the area between the sclera and conjunctiva, the choroidal retinal tissues, macula, or other area in or near of an individual's eye. In some modalities, the compositions are administered to the individual as an ocular implant.
[00140] [00140] The fusion proteins of the present invention are intended to be formulated, dosed, and administered in a manner consistent with good medical practice. Factors to be considered in this context include the disease or disorder to be treated, the particular mammal to be treated, the clinical condition of the individual patient, the cause of the disease or disorder, the place of delivery of the agent, the method of administration. - traction, the administration program, and other factors known to medical practitioners. The fusion protein does not need to be, but it is optionally formulated with one or more agents currently used to prevent or treat the disease or disorder in question. The effective amount of these other agents depends on the amount of fusion protein present in the formulation, the type of disease or disorder or treatment, and other factors discussed above. These are generally used in the same dosages and with routes of administration as described in the present invention, or from about 1 to 99% of the doses described in the present invention or in any one dose and by any route that is empirically / clinically determined to be adequate. Combination treatment
[00141] [00141] The fusion proteins of the present invention can be used alone or in combination with one or more additional therapeutic agents. Such combination therapies comprise combined administration (in which two or more therapeutic agents are included in the same or different formulations), and separate administration, in which case, administration of the fusion protein of the present invention can before, simultaneously, and / or subsequently, the administration of the additional therapeutic agent and / or adjuvant.
[00142] [00142] In some embodiments, a fusion protein is administered in combination with a therapeutic agent, including, but not limited to, a complement inhibitor (eg, ARC1905, TT30, Compstatin, and / or POT - 4) , a complement antibody (for example, eculizumab, FCFD4514S, TNX - 558, and / or TNX - 234), a VEGFR inhibitor (for example, sunitinib, sorafenib, vatalanib, and / or Vandetanib), VEGFR antibody (for example , Ramucirumab) or VEGF (for example, bevacizumab, O ranibizumab, Aflibercept, and / or pegapta-nib). For exemplary agents against complement proteins, see Ehrnthaller, C., et al., (2011), Mol. Med., 17: 317 to 329. According to other embodiments, a fusion protein is administered in combination with agents that include , but not limited to, anti-oxidants (eg vitamin C, vitamin E, beta - carotene, lutein and / or zeaxanthin), long-chain omega 3 fatty acids - (for example, docosahexaemoic acid and / or eicosapentaenoic acid), Zinc or copper. In another embodiment, a fusion protein is administered in combination with neuroprotective cytokines, including, but not limited to, ciliary neurotrophic factor. In other embodiments, a fusion protein is administered in combination with a laser treatment (for example, photodynamic therapy) in the case of AMD. In some embodiments, the combination of an effective amount of the fusion protein with one or more additional therapeutic agents is more effective compared to an effective amount of the fusion protein or other therapeutic agent alone.
[00143] [00143] In some embodiments, the fusion protein is administered by a different route than the administration of one or more additional therapeutic agents. In some modalities, one or more additional therapeutic agents are administered parenterally (for example, central venous line, intraarterial, intravenous, intramuscular, intraperitoneal, intradermal or subcutaneous), orally, gastrointestinally, topically, naso - pharyngeal and pulmonary (for example inhalation or intranasally).
[00144] [00144] Pharmaceutical formulations of a fusion protein, as described in the present invention are prepared by mixing, such fusion protein having the desired degree of purity, with one or more pharmaceutically acceptable, optional vehicles, in the form of lyophilized formulations or aqueous solutions. Pharmaceutically acceptable vehicles, excipients or stabilizers are described in the present invention and well known in the art (Remington: The Science and Practice of Pharmacy, 20th edition, Mack Publishing (2000)). Pharmaceutically acceptable carriers are generally non-toxic to receptors at the dosages and concentrations used, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants, including asorbic acid and methionine; preservatives (such as octadecyldi-methylbenzylammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol, 3 - pentanol , in - cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counterions such as sodium; metal complexes (for example, Zn - protein complexes); and / or nonionic surfactants, such as polyethylene glycol (PEG). Examples of pharmaceutically acceptable carriers in the present invention further include interstitial drug dispersing agents such as neutral soluble glycoproteins active hyaluronidase (sHA-
[00145] [00145] The formulation described in the present invention can also contain more than one active ingredient, as necessary for the particular indication to be treated, preferably those with complementary activities that do not adversely affect each other. For example, it may be desirable to additionally provide a VEGF or complement inhibitor. Such active ingredients are suitably present in combination in amounts that are effective for the intended purpose.
[00146] [00146] The active ingredients can be encapsulated in micro-capsules prepared, for example, by means of coaceration techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin and poly- (methylmethacrylate) microcapsules, respectively - in colloidal drug delivery systems (for example, liposomes, albumin microcounts, microemulsions, nanoparticles and nanocapsules) or in macroemulsions. These techniques are described in Pharmaceutical Sciences 16th edition by Remington, Osol, A. Ed .. (1980).
[00147] [00147] In some embodiments, pharmaceutical formulations comprising the fusion protein are suitable for parenteral administration. Among the acceptable vehicles and solvents are water, Ringer's solution, phosphate-buffered saline, and isotonic sodium chloride solution. In addition, sterile fixed oils are conventionally used as a solvent or suspending medium. For this purpose, any fixed mineral or mild non-mineral oil can be employed including synthetic mono- or diglycerides. In addition, fatty acids, such as the use of oleic acid in the preparation
[00148] [00148] Prolonged-release preparations can be prepared. Suitable examples of extended release preparations include semipermeable matrices of solid hydrophobic polymers containing the fusion protein, wherein the matrices are in the form of molded articles, for example, films, or microcapsules. The pharmaceutical compositions are suitable for use in a variety of drug delivery systems. For a brief review of the present methods for drug administration, see Langer, R. (1990) Science 249: 1527-33 (1990), which is incorporated into the present invention by reference.
[00149] [00149] The formulations to be used for in vivo administration are generally sterile. Sterility can easily be achieved, for example, through filtration through sterile filtration membranes. VIII. Manufacturing Articles or Kits
[00150] [00150] In another aspect, an article of manufacture, or kit, that is provided contains a formulation of fusion protein. The article or kit may further comprise instructions for its use in the methods of the present invention. Thus, in certain modalities, the article of manufacture, or kit, includes instructions for using the fusion protein in methods for the treatment or prevention of an inflammatory disease (for example, age-related macular degeneration ), complement-related disease, and / or cancer in one comprising administering to the individual an individual an effective amount of a fusion protein. In certain modalities, the individual is a human being.
[00151] [00151] The article of manufacture, or kit can also comprise a container. Suitable containers include, for example, bottles, vials (for example, double-chambered vials), syringes (such as single or double-chambered syringes) and test tubes. The container can be formed from a variety of materials such as glass or plastic. The container contains the formulation. The manufacturing article or kit may also comprise a packaging label or leaflet, which is on or associated with the container, may indicate instructions for reconstitution and / or use of the formulation. The label or leaflet may also indicate that the formulation is useful or intended for subcutaneous or other modes of administration for the treatment or prevention of an inflammatory disease (for example, age-related macular degeneration), a disease related to the complement, and / or cancer in an individual. The container containing the formulation can be a single-use vial or a multipurpose vial, which allows administration of repeat (eg 2-6) administrations to the reconstituted formulation. The article of manufacture, or kit, may further comprise a second container comprising a suitable diluent (for example, BWFI). After mixing the diluent and the lyophilized formulation, the final protein, polypeptide, or small molecule concentration in the reconstituted formulation will generally be at least 50 mg / ml. The manufacturing article or kit may also include other materials desirable from a commercial, therapeutic and user point of view, including other buffers, thinners, filters, needles, syringes and packaging inserts with instructions for use.
[00152] [00152] The article of manufacture, or kit described in the present invention optionally further comprises a container comprising a second drug, in which the fusion polypeptide is a first drug, and the article further comprises instructions on the package insert for treating the individual with the second drug, in an effective amount. The second drug can be any of those defined above, with a second exemplary drug being a complement inhibitor (eg, ARC1905, TT30, Compstatin, and / or POT - 4), a complement antibody (eg, eculizumab, FCFDA4514S , TNX - 558, and / or TNX - 234), a VEGFR inhibitor (for example, sunitinib, sorafenib, vatalanib, and / or Vandetanib), VEGFR antibody (for example, Ramucirumab) or VEGF (for example, bevaci - zumab, ranibizumab, Aflibercept, and / or pegaptanib) if the fusion protein is used for the treatment of age-related macular degeneration.
[00153] [00153] In another embodiment, a manufactured article, or kit, is provided in the present invention, comprising the formulations described in the present invention for administration in an autoinjector device. An autoinjector can be described as an injection device that, after activation, will deliver its content without the additional necessary action of the patient or administrator. They are particularly suitable for self-medication of therapeutic formulations when the release rate must be constant and the delivery time is longer than a few minutes.
[00154] [00154] Unit dosage forms are also provided for the treatment and / or prevention of inflammatory diseases (such as age-related macular degeneration), disease related to complement, and / or cancer, forms dosage forms comprising any of the fusion proteins or the formulations described in the present invention.
[00155] [00155] The present invention will be more fully understood by reference to the following examples. They should not, however, be construed as limiting the scope of the present invention. All quotations throughout the description are expressly incorporated into the present invention by reference.
[00156] [00156] To produce a series of fusion proteins comprising
[00157] [00157] Plasmids constructed for ACP-1 and ACP-10 were each transiently transfected into HEK293 cells. The cell culture medium in which ACPs were secreted was harvested 72 hours after transfection, and each ACP was purified by Protein A chromatography. Briefly, culture supernatants containing the secreted ACPs were mixed with protein A - agarose overnight before applying to a polypropylene column. The beads were washed with 0.1 M Tris, pH 8.0 before eluting the ACPs with elution buffer (0.1 M glycine buffer, pH 2.5) and neutralizing with Tris pH 8 buffer , 0. The eluted ACP's were concentrated and dialyzed against phosphate buffered saline
[00158] [00158] ACPs in which DAF SCR2 - 4, MCP - 4 SCR2, Factor H SCR 1-4, or CABPA SCR1 - 3 are each fused as a CID to the Igc1 Fc domain constructed, expressed and purified in a similar manner . Example 2: Inhibition of the classical complement pathway through ACP
[00159] [00159] The CH50 assay was used to quantify the degree of activity of the classic complement pathway. This assay determines the functional capacity of serum complement components of the classical pathway (ie, present in a sample) to lyse the red blood cells of sheep pre-coated with rabbit anti-sheep antibody from red blood cells (EA, sensitized sheep erythrocyte antibodies, Complementary Technology Catalog No. B200). When EA are incubated with, for example, test serum, magnesium ions and calcium ions, the classic complement pathway is activated and hemolysis results are obtained. An optimally fixed volume of sensitized EA is added to each dilution of the serum. After incubation, the mixture is centrifuged and the degree of hemolysis is quantified by measuring the absorbance of the hemoglobin released into the supernatant at - 540 nm. The amount of complement activity is determined by analyzing the ability of various dilutions of the test serum to smooth out EA. The test result is expressed as the reciprocal of the serum dilution needed to produce lysis of 50% of the defined red cell numbers under normal conditions.
[00160] [00160] The CH50 assay is sensitive to the reduction, absence and / or inactivity of any component of the classical complement pathway and, therefore, was used to evaluate the capacities of ACP - 6, -7, -9, and -10a inhibit classical complement activation. For this assay, the dilution of normal human serum (Complementary Technology Catalog No. SNS) which lysed 90% of 1 x 107 EA / ml after 1 hour incubation at 37 ° C was determined for the first time. The assay was carried out in GVB + + buffer (0.1% gelatin, vernal 5 mM, NaCl 145 MM, 0.025% NaN3, pH 7.3) containing CaCl2 at 0.15 mM and MgCl2 at 0, 5 mM. The inhibition of the classical complement pathway was activated by mixing the dilution of normal human serum, which can lyse 90% of EA, with 0 to 500 nM of ACP - 6, ACP-7, ACP-9, or ACP fusion proteins - 10 for 1 hour at 370C. EA hemolysis was then tested after 1 hour of serum incubation and by measuring EA absorption at OD541 nm. The data were analyzed using the sigmoidal fitting curve using Prism 4 (GraphPad, Inc.).
[00161] [00161] Analysis of the percentage of EA hemolysis in the presence of fusion proteins demonstrated that ACP - 6, in which the human CR1 SCR1 - 3 domain was fused to the IgG1 Fc Terminal C end, exhibited robust inhibition of a complement activity with EC50 of 16.2 nM (Figure 3A, closed circle). ACP - 7, in which the human CR29 SCR1 - 3 N29K / D109N variant was fused to the IgG1 Fc Terminal C end, significantly increased the inhibitory effect by 10 times the 1.6 nM EC50 (Figure 3A, closed square ). ACP - 9, in which the CR1 SCR1 - 3 N29K / DIO9N S37Y / G79D variant was fused to the IgG1 Terminal C end, boosted inhibitory activity more than 2.7 times the 0.6 nM EC50 (Figure 3A , the closed triangle). In contrast, ACP - 10, in which human CR1 SCR 8-10 was fused to the Terminal C end of IgG1, showed no inhibition of complement activity.
[00162] [00162] Inhibition of the classical complement pathway by ACP containing DAF SCR2 - 4, MCP - 4 SCR2, Factor H SCR 1-4, or C4BPA SCR1 - 3 CIDs is analyzed in a similar way. Example 3: Inhibition of the alternative complement pathway through ACPs
[00163] [00163] In contrast to the classical pathway and lectin, which require both magnesium and calcium ions for activation, activation of the alternative complement pathway requires only magnesium ions. Thus, to quantify the alternative activity of the complement in the presence of ACP's, the assay described above was modified in such a way that rabbit erythrocytes (ER) were incubated with serum, ACP at 0 at 500 nM, Mg2 + at 5 MM, and 5 mM EGTA, which are preferably chelated calcium ions.
[00164] [00164] For this assay, dilution of normal human serum (Complement Technology Catalog No. SNS) that lysed 90% of 1.25 x 107 rabbit erythrocytes / ml (Er, Complement Technology Catalog No. B300) was determined for the first time after 30 minutes of incubation at 37ºC. The assay was performed in GVBO buffer (0.1% gelatine, 5 mM Veronal, 145 mM NaCl, 0.025% NaN3, pH 7.3) containing 5 mM MgCl2 and 5 MM EGTA. The inhibition of the alternative complement pathway was initiated by mixing a dilution of normal human serum, which should smooth 90% of Er with O at 500 nM of the Fc ACP - 6, ACP - 7, ACP - 9 fusion proteins. , or ACP - 10 for 1 hour at 37ºC. Er hemolysis was then tested after 30 minutes of serum incubation and Er measuring the absorption at OD412nm. The data were analyzed using the sigmoidal assembly curve using Prism 4.
[00165] [00165] Analysis of the percentage of EA hemolysis in the presence of the fusion proteins demonstrated that ACP - 6 exhibited a very low inhibitory activity with EC50 of 319.9 nM (Figure 3B, closed circle). ACP - 7 exhibited a better inhibitory effect (2.5 times) at CE5O of 127.0 nM (Figure 3B, closed squares). ACP - 9 showed an even more inhibiting effect on CESO of 31.9 nM, that is, 10 times better than the wild type sequence (APC - 6) (Figure 3B, the closed tri-angle). In contrast, ACP - 10 had no effect on complement activity up to 500 nM (Figure 3B, inverted triangle).
[00166] [00166] The inhibition of the alternative complement pathway by ACPs containing DAF SCR2 - 4, MCP - 4 SCR2, Factor H SCR 1-4, or CA4BPA SCR1 - 3 CIDs was tested in a similar way. Example 4: Expression and purification of the bispecific ACVPs protein that inhibited both complement and VEGF pathways
[00167] [00167] A series of bispecific fusion proteins comprising a complement inhibition domain (CID), a VEGF inhibition domain (VID), and a Fe domain (i.e., the human IgG1 Fc region) has been produced (Figure 1B). The VID used for bispecific fusion proteins was a VEGFR1 D2 - VEGFR2 D3 fusion of the second Ig type domain of VEGFR1 and the third type domain lg VEGFR 2, that is, similar to the VEGF naked eye trap, which is also known as Aflibercept (see, for example, Frampton (2012) Drugs Aging 29: 839-46 and Ohr et al. (2012) Expert Opin Pharmacother 13: 585 to 91). A nucleic acid encoding the ACVP - 1 fusion protein was constructed by inserting a nucleic acid encoding the VID downstream of the signal peptide SP2 at Terminal N of ACP - 9 in plasmid pV131. The constructed ACVP - 1 plasmid was used to transiently transfect HEK293 cells. The cell culture medium containing the secreted ACVP - 1 was collected 72 hours after transfection, and the protein was purified by protein A chromatography. Briefly, the culture supernatant containing secreted ACVP - 1 was mixed with protein A - agarose overnight before applying to a polypropylene column. The beads were washed with 0.1 M Tris, pH 8.0 before eluting ACVP - 1 with elution buffer (0.1 M glycine buffer, pH 2.5) and neutralizing with pH Tris buffer 8.0. The eluted protein was concentrated and dialyzed against phosphate buffered saline (PBS) before determining the final protein concentration by the BCA assay. The purity of each ACVP - 1 isolate was determined to be> 90%. A sample of 2 ug of purified ACVP - 1 (tracks 1 and 3) was compared with purified ACP - 9 (tracks 2 and 4) running on an SDS - PAGE gel under reducing conditions (tracks 3 and 4) or without conditions of reduction (ranges 1 and 2) (Figure 2B). The molecular weight of the dimeric ACVP - 1 was - 139 kD.
[00168] [00168] The positions of the Fe, CID, and ACVP VID - 1 domains are reorganized in relation to each other. In addition, alternative CIDs, such as those present in ACPs, and alternate VIDs are used. The nucleic acid constructs that code for any of the ACVPs represented in Figure 18 are prepared and expressed in mammalian cells, as described above. Likewise, such ACVPs are purified by protein A chromatography, as described in the present invention.
[00169] [00169] —ACVPs containing DAF SCR2 -4, MCP SCR2 +, Factor H SCR 1-4, or C4BPA SCR1 - 3 CIDs are constructed. Example 5: In vitro binding of ACVPs to VEGF
[00170] [00170] ELISA were performed to determine whether ACVPs bind directly to VEGF. Briefly, the wells of a 96 well ELISA plate were coated with 100 ng of VEGF-A (available from R & D Systems). The 10 nM purified ACVP was then added to each well and incubated for 1 hour. After washing three times with 400 mL of PBS containing 0.1% (v / v) Tween 20, 100 µl of a dilution of anti - Fc HRP (Sigma Catalog
[00171] [00171] To assess the binding affinity of ACVPs to VEGF in solution, 5: 00 of VEGF - A, was incubated with O - 100 pM of a purified ACVP overnight at 4 ºC in RD5K dilution buffer (R & D Systems Catalog No. DVEO0O). After incubation, the concentration of free VEGF in the buffer was determined by sandwich ELISA using the human VEGF Quantitative ELISA Kit (R & D Systems Catalog No. DVEO0O). Data from two independent experiments using ACVP - 1 were analyzed using the sigmoidal fit curve using Prism 4. As shown in Figure 4B, ACVP - 1 exhibited a strong bond identical to VEGF with an affinity of 15:04.
[00172] [00172] ELISA tests were also performed to compare the binding affinities of ACVP -1, VID and Avastin for VEGF-A. The tested VID was a fragment of ACVP - 1, in which the VID has the Fc domain fused to its C-terminal. About 40pM of VEGF165 (293 - VE) was incubated with 1 nM of purified ACVP - 1, VID, or Avastin for 45 minutes at 37 º C. After incubation, free VEGF was detected using the Human EGF DuoSet ELISA Development Kit (R & D Systems Catalog No. DY293B) according to the manufacturer's instructions . The data were analyzed using the sigmoidal adjustment curve using Prism 4. As shown in Figure 4C, ACVP - 1 exhibits an affinity for VEGF (with an EC50 of
[00173] [00173] Other ACVPs (for example, containing DAF SCR2 -4, MCP SCR2 44, Factor H SCR 1-4, or C4BPA SCR1 -3 as CIDs) are assayed through their abilities to bind VEGF and to determine your binding affinities for VEGF as described above. Example 6: In vitro binding of ACPs or ACVPs to C3b or C4b
[00174] [00174] Allocation of ACPs or ACVPs to C3b or C4b is tested in direct experiments by Elisa. The wells of 96-well ELISA plates were coated with 100 ng / well of C3b or C4b (available from Complement Technology, Inc.). 0-1 µM of a purified ACP or ACVP depicted in Figure 1 is then added to each well and incubated for 1 hour. After washing C3b or unbound C4b, 100 µl of a 1: 5000 dilution of anti - Fc HRP (Sigm Catalog No. A0170 - 1 ml) is added to each well and incubated for 1 hour. After washing, the reagent is stopped for TMB Substrate (Sigma Catalog No. S5814 - 100 ml) which is added, and the absorbances OD450 nm are measured. Example 7: DAA inhibition for alternative convertases through ACPs or ACVPs
[00175] [00175] The decay of activity acceleration (DAA) for alternative C3-convertase is determined by ELISA. ELISA 96-well plate wells are first coated with 1 µg / ml of C3b (available from Complement Technology, Inc.) and then blocked. Each well is then incubated with 400 ng / ml B Factor (available from Complement Technology, Inc.), 25 ng / ml D factor (available Complement Technology, Inc.), and NICI2 to 2 mM. After washing, the C3bBb (Ni2 +) complexes attached to plates are incubated with different concentrations
[00176] [00176] DAA for C5 - alternative convertase is determined by ELISA, as described above, except that the wells of the ELISA plates are coated with 1 µg / ml of C3b dimers. Dimer C3b is generated by treating 2 mg of C3 (available from Complementary Technology, Inc.) with 20 µg of trypsin (available from Sigma, Inc.) in 200 µl of PBS for 3 min at 37 ° C. º C. The reaction is then stopped with 200 ng of soy trypsin inhibitor (available from Sigma, Inc.). C3b dimers are then formed after breaking the thioester bond for 3 days at 4 ° C, using 15 µg of 0.34 MM bismaleimido-hexane (available from Pierce, Inc.), dissolved in methanol. The C3b dimer is purified by means of SEC chromatography. Example 8: Inhibition of the classical complement pathway through LCAAs
[00177] [00177] The ability of ACVPs to inhibit the classical pathway of the complement was tested as described in Example 2. The test was performed in GVB + + buffer (0.1% gelatin, veronal to MM 5, NaCl a 145 mM, 0.025% NaN3, pH 7.3) containing 0.15 mM CaCl2 and 0.5 mM MgCl2. The inhibition of the classical complement pathway was activated by mixing the dilution of normal human serum, which can lyse 90% of EA, with O - 500 nM ACVP - 1 for 1 hour at 370C. Inhibition data were analyzed using the sigmoidal adjustment curve using Prism 4. As shown in Figure 5A, the bispecific fusion protein ACVP - 1 exhibited a very high inhibitory potency on classical complement activation, with an EC50 of 0.19 nM.
[00178] [00178] Other ACVPs (for example, containing DAF SCR2 - 4, MCP - 4 SCR2, Factor H SCR 1-4, or CABPA SCR1 - 3 as CIDs) are tested as described in the present invention, to determine their ability to inhibit the classic complement pathway. Example 9: Inhibition of the alternative complement pathway through LCAAs
[00179] [00179] The ability of ACVPs to inhibit the alternative complement pathway was assayed as described in Example 3. The assay was performed in GVBO buffer (0.1% gelatin, 5 mM Veronal, 145 mM NaCl, 0.025% NaN3, pH 7.3) containing 5 mM MgCl2 and 5 mM EGTA. Inhibition of the alternative complement pathway was initiated by mixing a dilution of normal human serum, which can lyse 90% Er with O - 500 nM ACVP - 1 for 1 hour at 370C. Er hemolysis was then tested after 30 minutes of incubation of the serum and Er. The inhibition data were analyzed using the sigmoidal adjustment curve using Prism 4. As shown in Figure 5B, the bispecific ACVP - 1 of the fusion protein exhibited an extremely potent inhibitory effect of the alternative activation of the complement, with an EC50 of 21.1 nM.
[00180] [00180] Other ACVPs (for example, containing DAF SCR2 - 4, MCP - 4 SCR2, Factor H SCR 1-4, or CABPA SCR1 - 3 as CIDs) are tested as described above, to determine their ability to inhibit the alternative complement pathway. Example 10: Inhibition of HUVEC proliferation VEGF-dependent assay by means of ACVPs
[00181] [00181] ACVPs are tested for their ability to inhibit the VEGF signaling pathway (for example, inhibition of the activity of
[00182] [00182] For example, ACVP - 1 was tested for its ability to inhibit the VEGF signaling pathway (eg, the inhibition of VEGF activity) in this cell-based assay and compared to the VEGF inhibitory activity of a CID and a VID. The tested VID was a fragment of ACVP - 1, in which the VID has the Fc domain merged with its C terminal. The CID was tested on an ACVP - 1 fragment, in which the CID has the Fc domain merged with its its N-Terminal. To measure proliferation of endothelial cells, human umbilical vein endothelial cells (HUVECSs, available from Lonza, Inc.), were seeded in 96-well plates (4 x 104 cells / well) with EndoGRO - VEGF Complete Medium Kit. After 24 hours, the cells were washed with PBS and incubated with 35nm per ml ACVP - 1, VID, or CID, in the presence of 0.3 nM FCEVI65 in DMEM supplemented with 20% FBS. For controls, cells were incubated with PBS, DMEM supplemented with 20% FBS,
[00183] [00183] ACVPs are tested for their ability to inhibit the activation of intracellular signaling downstream by a VEGFR pathway. In this assay, HUVEC cells are pretreated with 3 nmol / ml of IgG, VID, CID, or an ACVP for 30 minutes and then stimulated with 3 nmol / ml VEGF165 for an additional 10 minutes. The cells are harvested and analyzed by Western blot, in which VEGFR (for example, VEG-FR1, VEGFR2 or FCEVR3), AKT phosphorylation and ERK are evaluated. GAPDH is used as a load control. Blocked membranes are probed with primary antibodies against phosphorylated VEGFR (for example, VEGFR1, VEGFR2 or FCEVR3), GAPDH (1: 3000 dilution; Cell Signaling Technology, Beverly, MA), Phosphorylated Erk (p - Erk) , Erk protein, phosphorylated AKT (p - AKkt), and overnight AKkt protein at 4 ºC. After washing off the primary antibodies, secondary antibodies conjugated to horseradish peroxidase (HRP) are added to the membranes and incubated at room temperature for 1 hour before further washing and the protein was visualized with a chemiluminescent substrate for HRP.
[00184] [00184] For example, ACVP - 1 has been tested for its ability to inhibit the activation of ERK and AKT via the VEGFR2 pathway. In this assay, HUVEC cells were pretreated with 3 nmol / ml of IgG, VID, CID, or ACVP - 1 for 30 minutes and then stimulated with 3 nmol / ml VEGF165 for another 10 minutes. The tested VID was a fragment of ACVP - 1, in which the VID has the Fc domain merged with its C terminal. The CID was tested a fragment of ACVP - 1, in which the CID has the Fc domain merged with its its Terminal N. The cells were harvested and analyzed by Western blot, in which VEGFR2, AKT and ERK phosphorylation were evaluated. GAPDH was used as a load control. The blocked membranes were probed with primary antibodies against phosphorylated VEGFR 2, (1: 1000 dilution; Cell Signaling Technology, Beverly, MA), GAPDH (1: 3000 dilution; Cell Signaling Technology, Beverly, MA), Erk phosphorylated (p - Erk), Erk protein, phosphorylated AKT (p - AKkt), and AKkt protein overnight at 4 ºC. After washing the primary antibodies, the secondary antibodies conjugated to horseradish peroxidase (HRP) were added to the membranes and incubated at room temperature for 1 hour, before re-washing and visualizing the protein by a chemiluminescent substrate for HRP. As shown in Figure 7, ACVP - 1 and VID inhibited VEGF165 which induced VEGFR2, ERK, and AKT phosphorylation, and CID inhibited ERK phosphorylation.
[00185] [00185] Choroidal neovascularization (CNV) is a common symptom of wet age-related macular degeneration (AMD). CNV occurs when new blood vessels that originate in the choroid layer of the eye grow through a break or defect in Bruch's membrane and invade the retinal pigment epithelium or sub-retinal subspace. This process constitutes the scar tissue that ultimately causes blindness. Laser-induced choroidal neovascularization (CNV) as an animal model is used to test treatments for exudative AMD. For example, this model can be used to assess the ability of ACVPs to inhibit CNV.
[00186] [00186] - Laser-induced CNV in mice is used to test the ability of ACVPs and ACPs to inhibit CNV. In this trial, the mice are anesthetized with ketamine hydrochloride (100 mg / kg body weight) and the pupils are dilated with 1% tropicamide, three 532 nm photo-coagulation diode burns with laser are delivered to each retina. Burns are performed on the 9th, 12th, and 3 positions of the posterior pole of the retina. The production of a bubble at the time of the laser, which indicates the rupture of the Bruch's membrane, is an important factor in obtaining CNV. To test the ability of an ACVP or ACP to prevent the formation of laser-induced CNV, a 41ug ACVP or ACP is injected intravitreally, on the same day as the laser burn. At 14 days after the laser injury, the mice are injected intravenously with 50 mg of fluorescein-labeled dextran and euthanized. The rats' eyes are then dissected into flat choroidal assemblies to assess the change in the size of the NVC lesions. Example 13: Inhibition of laser-induced CNV in monkeys by means of ACVPs
[00187] [00187] —CNV laser-induced in monkey is used to test the ability of ACVPs and ACPs to inhibit CNV. Briefly, 6 to 9 532 nm laser photocoagulation diode burns are delivered around the macula in each eye. A dosage of 0.1 to 0.5 mg of an ACVP is injected intra-vitreally on the same day of flaring. About 20 days later, the animals are sedated with 2.5% soluble pentobarbitone intravenously (1 mL / kg). The eyelids are fixed to keep the eye open and accessible. Color photographs are first taken with an eyepiece camera. After the initial fluorescein photograph (20% 0.05 ml sodium fluorescein /
[00188] [00188] For example, a laser-induced CNV model was created in Rhesus monkeys, ranging in age from 3 to 6 years old. A total of eight monkeys were divided into the following four groups that were administered: 1) vehicle control (PBS); 2) ACVP1 (0.5 mg / eye); 3) VID (0.5 mg / eye); or 4) ICD (0.5 mg / eye). In total, there were two monkeys (four eyes) per group. The tested VID was a fragment of ACVP - 1, in which the VID has the Fc domain fused to its C terminal. The CID was tested a fragment of ACVP - 1, in which the CID has the Fc domain fused to its Terminal. N. About 6 to 9 532 nm diode laser photo coagulation burns were delivered around the macula in each eye. Vehicle control (PBS) or a dose of 0.5 mg ACVP -1, VID, or CID, was an intravitreal injection 21 days after the laser burn. Fourteen days after the administration of the dose, the animals were sedated with 2.5% soluble pentobarbitone intravenously (1 mL / kg). The eyelids were fixed to keep the eye open and accessible. The color photographs were taken first using an eye fundus camera. After the initial photograph, fluorescein (20% sodium fluorescein at 0.05 ml / kg) was injected via a lower extremity vein. The photographs were taken 5 minutes after the dye injection, including the arterial phase, arteriovenous early phase, and several final arteriovenous phases to monitor the leakage of fluorescein associated with CNV lesions. The local area in the photo was measured as a leak area. Analysis of leakage point photographs showed that the leakage area that the average of the vehicle treated group was greater at 14 days post
[00189] [00189] Various human cancer cells, such as Hep3B human hepatocellular carcinoma (ATCC * HB - 8064) and LoVo human colorectal cancer cells (ATCC * CCL - 229), can be used to establish xenograft models in camun - naked dongos. In order to assess the inhibitory effects of ACP and ACVPs on tumor growth, various concentrations of each ACP and each ACVP (for example, 0.1-10 mg / kg) are administered intravenously twice a week in mice after tumor cell implantation. Tumor growth is measured weekly for up to 7 weeks. Example 15: Pharmacokinetic assessment of ACP and LCAAs in mice and monkeys
[00190] [00190] A dose of 10 to 40 mg / kg of each ACP and ACVP is administered to mice or monkeys, through subcutaneous injection or intravenous injection. Serum samples are taken at different time points after injection, for up to 15 days. The concentrations of each ACP or ACVP fusion protein in the serum samples are determined using an sandwiched ELISA assay.
SEQUENCES SCR1-3 human CRI amino acid and nucleic acid sequences 1 caatgcaatg ccecagaatg gettecattt gccaggecta ccaacetaac tgatgaattt
Q ECN APE WL PF ARP TNL T DEF 61 gagtttccca ttgggacata tetgaactat gaatgcegec ctggttatte cggaagaceg
E F P GT Y L NY E C R P GY S GG RP 121 ttttctatca tetgcetaaa aaactcagte tggactggtyg ctaaggacag gtgcagacgt
FS TI LI CL KNSV WTG AKD RCRR 181 aaatcatgte gtaatectec agatectgtg aatggcatgg tgcatgtgat caaaggcate
K SC RNP P DPV NGM VHV IKGI 241 cagtteggat cccaaattaa atattcttgt actaaaggat accgactcat tggttccteg Q FG SS I K Y 8 C T K L Y R L I L SS 301 tectgccacat gcateatete aggtgatact gtcatttggy ataatgaaac acctatttgt S CC I I Ss 6 DT VvV R W A N E T P CC 361 gacagaatte cttgtgggct accceccace atcaccaatg gagatttcat tagcaccaac
DRI PCG LPPT ITN GDF ISTN 421 agagagaatt ttcactatgg atcagtggtg acctaccgct gcaatectgg aagcggagyg R EN FHY GSVV TYR CNP GS6GG 481 agaaaggtgt ttgagcttgt gggtgagece tecatatact gcaccageaa tgacgatcaa RK vV FEB PEG Ss IY Cc TS N DODOQO 541 gtgggcatet ggageggece cgececteay tgcatt (SEQ ID NO: 17) V GI WS G PAPO CI (SEQIDNO: 1) Human CRI SCR1-3 N29K / DIO9N amino acid and nucleic acid sequences 1 caatgcaatg ccccagaatg gcttecattt gccaggecta ccaacctaac tgatgaattt
Q CN A FP E W L P F A R P T N L T D E F 61 gagtttccca ttgggacata tetgaaatat gaatgcegec ctggttatte cggaagaceg
E FP IGT YLKY ECR PGTY SGRFPF 121 ttttctatca tctgcetaaa aaactcagte tggactggtg ctaaggacag gtgcagacgt
FS TI LI CL KNSV WTG AKD RCRR 181 aaatcatgtc gtaatectec agatectgtg aatggcatgg tgcatgtgat caaaggcate
K SC RNP PDPV NGM VHV IKGI 241 cagtteggat cccaaattaa atattcttgt actaaaggat accgactcat tggttccteg
Q FG SQI KYSC TKG YRL IGSS 301 tetgccacat gcateatete aggtaatact gtcatttogy ataatgaaac acctatttgt SAT CII SGNT VI1IW DNE TP1C 361 gacagaatte cttgtgggct accceccace atcaccaatg gagatttcatc
DRI PCG LPPT ITN GDF ISTN 421 agagagaatt ttcactatgg atcagtggtg acctaccgct gcaatectgg aageggaggg R EN FHY GSVV TYR CNP GS6GCG 481 agaaaggtgt ttgagcttgt gggtgagcce tecatatact gcaccagcaa tgacgatcaa RK vV FEVGEP Ss IY Cc TS ND 541 gtgggcatet ggageggece cgceeeteag tgcatt (SEQ ID NO: 18) ve W SG PA PQ C II (SEQIDNO: 2) SCR1-3 S37Y / G79D Human CRI amino acid and nucleic acid sequences 1 caatgcaatg ccecagaaty gettecattt gccaggecta ccaacetaac tgatgaattt
Q CN APFPE WL PF AR P TNL T DEF 61 gagtttccca ttgggacata tetgaactat gaatgcegec ctggttatta cggaagaceg
E FP IGT YLNY ECR PGTY YGRP 121 ttttctatca tetgcctaaa aaactcagte tggactggty ctaaggacag gtgcagacgt
FS TI ICL KNSV WTG AKD RCRR 181 aaatcatgte gtaatectec agatectgtg aatggcatgg tgcatgtgat caaagacatc
K SC RNP PDPV NGM VHV IKDI 241 cagtteggat cccraaattaa atattcttgt actaaaggat accgactcat tggttccteg Q FG SS I K Y SS C T K L Y R L I GE SS 301 totgccacat geateatete aggtgatact gtcatttagyg ataatgaaac acctatttgt S CC I I Ss GG DT VvV I W D NE T P CC 361 gacagaatte cttgtgggct accceccace atcaccaatg gagatttcat tagcaccaac
DRI PCG LPPT ITN GDF ISTN 421 agagagaatt ttcactatgg atcagtggtg acctaccgct gcaatectgg aageggaggg
R EN FHY GSVV TYR CNP GS6GEG 481 agaaaggtgt ttgagettgt gggtgagece tecatatact gcaccageaa tgacgatcaa
R KV FEL VGEP SIY CTS NDDO 541 gtgggcatet ggageggece cgceeeteag tgcatt (SEQ IDNO: 19) ve WS PA PQ C II (SEQIDNO: 3) Amino acid and nucleic acid sequences SCR1-3 N29K / S37Y / G79D / CR1 Humane 1gatat CR1 Human ccccagaatg gettecattt goecaggecta ccaacetaac tgatgaattt
Q ECN APE WL PF AR P TNL T DEF 61 gagtttccca ttgyggacata tetgaaatat gaatgcegee ctggttatta cggaagaceg
E FP IGT YLKY ECR PGY YGRP 121 ttttotatea tetgectaaa aaacteagte tggactggtg ctaaggacag gtgcagacgt
F SI ICL KNSV WTG AKD RCRR 181 aaatcatgte gtaatectec agatectgtg aatggcatygg tgcatgtgat caaagacate
K SC RNP PDPV NGM VRHV IKDI 241 cagtteggat cccaaattaa atattcttgt actaaaggat accgacteat tggttecteg
Q FG SQI KYSC TKG YRL IGSS 301 totgccacat gcateatete aggtaatact gtcatttggg ataatgaaac acctatttgt
SAT CII SGNT VIW DNE T PIC 361 gacagaatte cttgtggget accceecace ateacceaatg gagatttcat tagcaccaac
DRI PCG LPPT ITN GDF ISTN 421 agagagaatt ttcactatgg atcagtggtg acctaceget gcaatectgg aageggaggg
R EN FHY GSVV TYR CNP GSGEEG 481 agaaaggtgt ttgagcttgt gagtgageco tecatatact gcaccageaa tgacgatcaa
R KV FE V GEP SI YC TS NDDÇO 541 gtgggcatet ggageggece cgceeeteag tgcatt (SEQ ID NO: 20) V GI WS G PA PQ CI (SEQIDNO: 4) Amino acid and nucleic acid sequences SCR8-10 of CR1 Human 1 cactgtcat gagagttag gt aaacccaaac caatgcatect H C Q AP D HF LF AKL K TO TNAS
61 gactttccca ttgggacate tttaaagtac gaatgcegte ctgagtacta cgggaggeca
DF P IGT SLKY ECR PE Y YGRP 121 ttctetatea catgtetaga taacctggte tggtcaagte ccaaagatgt ctgtaaacgt
FS T CL DN V WS SS PK D VC KR 181 aaatcatgta aaactecctec agatccagtg aatggcatgg tgcatgtgat cacagacatec
K SC KT P PDPV NGM VRHV ITDI 241 caggttggat ccagaatcaa ctattettgt actacagggec acegacteat tggtcactea
Q VG SRI NYSC TTG HRL IGHS 301 toctgetgaat gtatectete gageaatgct geccattgga gcacgaagec gecaatttgt S and C IL SGNA AH W STK PPI1IC 361 caacgaattec cttgtgggct acceccecace ategecaatg gagatttcat tagcaccaac 2 RP CG LP EN IAN L DF IS TN 4121 agagagaatt ttcactatgg atcagtggtg acctacegct gcaatectgyg aageggaggo REN FHY GSVV TYR CNP GS6GEG 4181 agaaaggtgt ttgagcttgt gggtgageco tecatatact gcaccageaa tgacgatcaa R KV FEL V GEP S1IY CTS NDDÇO 541 gtgggcatet ggageggece ggceceteag SEQEID NO: 5QQIDID (SEQIDID) Human CR1 1 caatgcaatg ccccagaatyg gettecattt gocaggecta ccaacetaac tgatgaattt
Q ECN APE W LPF AR P TNL T DEF 61 gagtttccca ttgggacata tetgaactat gaatgcegee ctagttatte cggaagaceg
E FP IGT YLNY ECR PGY SGRP 121 ttttctatea tetgectaaa aaactcagte tggactggtg ctaaggacag gtgcagacgt FS 1 CL K NS V W TG AKD RCRR 181 aaatcatgte gtaatectec agatectgtg aatatggggg tg
K SC RNP P DPV NGM VHV IKGI 241 cagtteggat cccaaattaa atattcttgt actaaaggat acegacteat tggttecteg EQ FG SQI KYSC TKG YRL IGSS
301 tetgccacat gcateatete aggtgatact gtcatttggg ataatgaaac acctatttgt SAT CI SGDT VIW DNE TP1C 361 gacagaattc cttgtgggct acccecccace atcaccaatg gagatttcat tagcaccaac
DRI PCG LPPT ITN GDF ISTN 421 agagagaatt ttcactatgg atcagtggty acctaceget gcaatectgg aageggaggg R FHY GSVV EN 481 TYR CNP GS6GEG agaaaggtgt ttgagcttgt gggtgageco tecatatact gcaccagcaa tgacgatcaa R KV FEL VGEP S1IY CTS NDDO 541 gtgggcatct ggageggece cgcceeteag tygcattatac ctaacaaatg cacgccteca
V GI WSG PAPQ CII PNK CTPP 601 aatgtggaaa atggaatatt ggtatctgac aacagaaget tattttectt aaatgaagtt
N VE NGI LVSD NRS LFS LNEV 661 gtggagttta ggtgtcagec tggetttgte atgaaaggac ccegeegtygt gaagtgccag
V EF RCQO PGFV MKG PRR VKCO 721 gcectgaaca aatgggagec ggagetacca agctgcteca gggtatgtea gecaceteca
A LN K WE P ELF SCS RVC QPPP 781 gatgtcctgc atgctgageg tacccaaagg gacaaggaca acttttcacc tgggcaggaa DV L HAE RTOR DK D NFS P6GQOQE 841 gtgttctaca getgtgagec cggetacggggggggggggggggggggggggggggggggggggggggggggggggt
V FY SCE PGYD LRG AAS MRCT 901 ccccagyggag actggagece tgcagcceee acatgtyaag tgaaatcctg tgatgactte
PQG DWS PAAP TCE VKS C D DF 961 atgggccaac ttcttaatgg cegtgtgcta tttccagtaa atctecaget tggagcaaaa
M GQ LLN GRVL FP V NLOQO LGARK 1021 gtggattttg tttgtgatga aggatttcaa ttaaaaggea gctetgetag ttactgtgte
V DF VCD EGFQO LKG SSA SS Y CV 1081 ttggctggaa tggaaagect ttggaatage agtgttocag tgtgtgaaca aatettttgt L AG MES LWNS SVP VCE Q1IFC 1141 ccaagtcete cagttattcc taatgyggactacetagga PSP PVI PNGR HTG KPL EVFP
1201 tttgggaaaa cagtaaatta cacatgcgac ccecacecag acagagyggac gagettegac
FGK T VN YTCD PHP DRG TSFD 1261 ctcattggag agagcaccat cegetgcaca agtgaccete aagggaatgg ggtttggage L I G ff R CT Ss) Q Q NG G V WS 1321 agcectgece ctegetgtgyg aattctgggt cactgtcaag ccccagatea ttttetgttt S P P ROC G G H CC Q A P H F L F 1381 gccaagttga aaacccaaac caatgcatet gactttecca ttgyggacate tttaaagtac
A KL K TO TNAS DF P IGT SLKY 1441 gaatgcegte ctgagtacta cgggaggecca ttetetatea catgtetaga taacetggte E CR PEY YGRP FSI1I TCL DNLV 1501 tggtcaagte ccaaagatgt ctgtaaacgt aaatatatagagecec aa aaatatgagta aaatatatagagecec aa aaatatgag PK D VOC K R K S C K T P P D PV 1561 aatggcatgg tgcatgtgat cacagacatc caggttggat ccagaatcaa ctattettgt
N GM VHV IT DI QVG SRI NYSC 1621 actacaggge acegacteat tggteactea tetgctgaat gratectete gggcaatget
T TG HRL IGHS SAE C IL SGNA 1681 gcccattgga gcacgaagec gecaatttgt caacgaatte cttgtggget accccecace
HW STK PPIC QRI PCG LPPT 1741 atcgccaatg gagatttcat tagcaccaac agagagaatt ttcactatgg atcagtggtg
I A N G DF S TN R E N F HH Y GS VV 1801 acctaceget geaatectgg aageggagygy agaaaggtgt ttgagettgt gggtgagece
T YR CNP GSGG RKV FEL V GEP 1861 tocatatact gcaccageaa tgacgatcaa gtgggcatet ggageggece ggccectrag
S IY C TS NDDQO VGI WS G PAPO 1921 tgcatt (SEQ IDNO: 22) C TI (SEQIDNO: 6) Amino acid and nucleic acid sequences Fc n Human IgGl 1 gacaaaacte acacatgcee acegtgceca geacetgaae tectaggggg acegteagte
D KT HTC PPCP APE L LG GPSV 61 ttcctettee cecraaaace caaggacace cteatgatet cceggacece tgaggteaca
F LF PPK PKDT LMI SRT PEVT 121 tgcgtygtggy tggacgtgag ccacgaagac cctgaggtca agttcaactg gtacgtogac Cc vv V DV SHED PEV KFN WYVD 181 ggcgtggagg tgcagagggggaggggg
G VE VHN AKTK PRE AND QY NS TY 241 cgtgtggtca gegtecteac cegtectgcac caggactgge tgaatggcaa ggagtacaag
R VV SVL TVLH QDMW LNG KEYK 301 tgcaaggtct ccaacaaage ceteccages cecategaga aaaccatete caaagccaaa C KV SNK AL PA PIE KTI1I SKAK 361 gggcagcece gagaaccaca ggtgtacace ccgggga gatac
GQ P REP QVYT LPP SRE AND MTK 421 aaccaggtca gcetgacetg cetggteaaa ggcttoetate ccagegacat cgcegtagag
NQV SLT CLVK Y GF PSD 481 tgggagagca atgggcagcc ggagaacaac IAVE tacaagacca cgcetecegt getggactee W PENN ES N6GOQO YKT P TP VLDS 541 gacggctect tettecteta tagcaagete acegtggaca agagcaggty gcagcagggy DGS FFL YSKL DTV 601 K SR W0Q006G6 aacgtcttet catgeteegt gatgcatgag getetygcaca accactatac gcagaagage
NV F SCS VMHE ALH NHY TOKS 661 ctetecetgt cteegggtaa a (SEQ IDNO: 23) L SL S PG K (SEQIDNO: 7) Amino acid and nucleic acid sequences G6 1 ggaggtggag goeggtggt (SEQ ID NO: 24) G GG G GG (SEQIDNO : 88 SPl 1 amino acid and nucleic acid sequences atggcctgga tgatycttet ccteggacte cttgcttatg gatcaggagt cgactet (SEQ ID NO: 25) M AW MML LLGL LAY GSG V DS (SEQID NO: 9)
Amino acid and nucleic acid sequences SP2 1 atggagacag acacactect getatgggta ctgctgetet gggttecagg gtegactage
MET DTL LLWV LLL W VP GSTEG 61 gacact (SEQ IDNO: 26) DT (SEQ IDNO: 10) Amino acid and nucleic acid sequences VEGFR-1 D2-VEGFR-2 D3 1 ggtagacctt tegtagagat gracagtgaa atcccegaaa ttatacac ga I PE I 1H MTEG 61 agggagecteg teattecetg cegggttacg tcacetaaca teactgttac tttaaaaaag
REL VIP CRVT SPN ITV TLKK 121 tttccacttg acactttgat ccctgatgga aaacgcataa tctgggacag tagaaaggge F PL DT P DG KRI1I IWD SRKG 181 ttcatcatat caaatgcaac gtacaaagaa atagggctte tgacctgga agg
F II SNA TYKE IGL LTC AND ATV 241 aatgggcatt tgtataagac aaactatctec acacategac aaaccaatac aatcatagat NGH LYK TNYL THR QTN TI11D 301 gtggttctga gteegtetea tagaattgaa ctatetgttg gagaaag
V V L S PS HGTIE LS V GEK LV LN 361 tgtacagcaa gaactgaact aaatgtgggg attgacttca actgggaata ccettetteg
CTA RTE LNVG I DF NWE Y P SS 421 aagcatcage ataagaaact tgtaaaccga gacctaaaaa cccagtetgg gagtgagato
K HE Q HKK LV NR DLK TOS GSEM 4181 aagaaatttt tgagcacctt aactatagat ggtgtaaccc ggagtgacca aggattgtac
K K F LST LTID GVT RS D QGLY 541 acctgtgcag catccagtgg gctgatgacc aagaagaaca gcacatttgt cagggtccat
T CA ASS GLMT KKN STF VRVH 601 gaaaag (SEQ IDNO: 27) AND K (SEQIDNO: 11) Amino acid and nucleic acid sequences ACVP-1
1 ggaagacctt ttgttgaaat gtattctgaa attcctgaaa ttattcatat gactgaagga G RP F VE MYSE I PE II 1H MTEG 61 agagaacttg ttattcettg tagagttact tetectaata ttactgttac tettaagaag
R EL VIP CRVT SPN ITV TLKK 121 tttectettg atactettat tectgatgga aagagaatta tttgggatte tagaaagyga F PL DTL IP DG KRI1I IWD SRK6G 181 tttattattt ctaatgctac ttataaggaa attggacttc ttacttggga
F II SNA TYKE IGL LTC AND ATV 241 aatggacatc tttataagac taattatctt actcatagac aaactaatac catcatcgac NGH LYK TNYL THR QTN TI1I1LD 301 gtggttetga gteegtetoa tggaattgaa ctatctgttga gaga
VV L SPSS HGIFE LSV GEK LVLN 361 tgtacagcaa gaactgaact aaatgtggyg attgacttca actgggaata cccttetteg
CTA RTE LNVG I DF NWE Y P SS 421 aagcatcagc ataagaaact tgtaaaccga gacctaaaaa cccagtetgg gagtgagato
K H Q H KK LV NR DLK TOS GSEM 481 aagaaattct tgagcaccct gactatagat ggtgtaaccc ggagtgacca aggattgtac
K KF LST LTID GVT RSD QGLY 541 acctgtgcag catccagtgy gctgatgace aagaagaaca gcacatttgt cagggtecat
T CA ASS GLMT KKN STF VRVHE 601 gaaaaagaca aaactcacac atgtccaceg tgtccagecac ctgaactect gggtggaceg
E K D K THB TCPP CPA PEL LGGP 661 tcagtettee tettecaeea aaaacccaag gacaccetea tgateteceg gacccctgag
SVF LF P PKPRK DTL MIS RTPE 721 gtcacatgeg tagtggtaga cgtgagecac gaagacectg aggtcaagtt caactagtac
VTC VVV DVSH AND DP AND VRK FNWVWY 781 gtggacggcg tggaggtgca taatgccaag acaaageege gggaggagea gtacaacage
V DG VEV HNARK TKP REE QYNS 841 acgtacegtg tggtcagegt ceteacegte ctgcaceagg actggctgaa tggcaaggag T YR V VS VLTV LHQ DWL NGKE
901 tacaagtgca aggtctccaa caaagecete ccagecececa tegagaaaao catctecaaa Y K Cc K VS NKAL PAP IEK T1ISK 961 gccaaaggge agcccegaga accacaggty tacaccetge ceceateceg ggatgagetg
A KG Q PR E POQV YTL PPS R DEL 1021 accaagaacc aggtcagect gacctgccty gtraaagget tetateccag cgacategec
TKN QVS LTCL VKG FYP S DAY 1081 gtggagtygy agagcaatgy gcagceggag aacaactaca agaccacgce tecegtgeta
V E W E SN GQPE NNY K TT PPVL 1141 gactcegacgy getecttett cctetacage aageteaceg tggacaagag caggtggcag
DS D GSF FLYS KLT V DK SRYMYWO 1201 caggggaacy tetteteatyg cteegtgatyg catgaggete tgcacaacea ctacacgcag Q GN VFS CSsSvVM HEA LHN HY TO 1261 aagagcctet cectgtetee gggga
K SL S LS PGKG GGG GGCOQ CNAP 1321 gaatggctte catttgccag gcctaccaac ctaactgatg aatttgagtt tcccattggg And WL PFA RPTN LTD EFE FPI1G 1381 acatatctga aatatgaatg ccgccctagt tattacggaa gacegtttte tatcatetge T YL KYE CRPG YYG RPF S11C 1441 ctaaaaaact cagtctggac tggtgctaag gacaggtgca gacgtaaate atgtegtaat
G KN SVW TGARK CKD RRK S CRN 1501 cctecagate ctgtgaatgy catggtgcat gtgatcaaag acatccagtt cggatcccaa Pd PVN GMVH VI1IK DI1IQ FGSO 1561 attaaatatt cttgtactaa aggataccga ctcattggtt cctegtetge cacatgcate I1TKY SCT KGYR ON SSS Atci 1621 atctcaggta atactgtcat ttgggataat gaaacaccta tttgtgacag aattccttgt 1 SG NTV IWDN ETP I CD INCP 1681 gggctaccce ceaccateac caatggagat ttcattagca ccaacagaga gaattttcac
GLP PTI TNGD FIS TNR ENFH 1741 tatggatcag tggtgaccta ccgctgcaat cctggaageg gagggagaaa ggtgtttgag Y GS vV VT YRCN PGS GGR KVFE
1801 cttgtgggtg agccctecat atactgcace agcaatgacg atcaagtggg catctggage
L VG AND PS IYCT SND DOV GIMWS 1861 ggcecegeac ctreagtgcat t (SEQ IDNO: 28) G PA PQC (SEQ ID NO: 12) Aminacid and nucleic acid sequences DAF SCR2-4 1 egtagetgeg aggtygccaac aaggctaaat tetgataat tatgataat tetgataat SAS L KQ PYI1IT 61 cagaattatt ttccagtegyg tactgttgtg gaatatgagt gcegtecagg ttacagaaga
Q NY F PV GTVV EYE CRP GYRR 121 gaaccttete tatcaccaaa actaacttgc cttcagaatt taaaatggtec cacagcagte and PS LS P K G TC G Q N K W are AV 181 gaattttgta aaaagaaatec atgccetaat ccgggagaaa tacgaaatgg tcagattgat and Fc KKK SC PN PGE I RN GoQID 241 gtaccaggtg gcatattatt tggtgcaace atetecttet catgtaacac agggtacaaa
V PG GIL FGAT IS F SCN TGYK 301 ttatttggct cgacttetag tttttgtett atttcaggca getetgteca gtggagtgac L F G Ss TS S F Cc L I Ss 6 Ss Ss vV EQ W SD 361 cegttgccag agtgcagga aatattatt
PL P ECR EIYC PAP PQOQI DNGI 421 attcaagggyg aacgtgacca ttatggatat agacagtctg taacgtatgc atgtaataaa 1Q0QG ER D HY GY ROS VT Y ACNK 4181 ggattcacca tgattggaga gcactetatt tattgtactg tgaataatga tgaaggagag GF T MIG EHSI1I YCT VNN GE 541 tggagtggce caccacetga atgcaga (SEQ ID NO: 29) W ss EPPPECR (SEQ ID NO: 13) Amino acid and nucleic acid sequences MCP SCR2-4 1 agagaaacat gtccatatat acgggatcet ttaaatggece aageagtece tgcaaatogg R ET C PY IR DP LNG QAV PANG
61 acttacgagt ttggttatca gatgcacttt atttgtaatg agggttatta cttaattogt T YE FGY QMHF ICN EGY YLI1IG 121 gaagaaatte tatattgtga acttaaagga tcagtagcaa tttggagegg taageceeca
E E L Y C E L K G S VA I WS G K P P 181 atatgtgaaa aggttttgtg tacaccacct ccaaaaataa aaaatggaaa acacaccttt I1TCE KVL CTPP PKI KNG KRHETF 241 agtgaagtag aagtgttt gt
S EV E VF EYLD A VT YSC DPA FP 301 ggaccagatec cattttcact tattggagag agcacgattt attgtggtga caattcagtg GP D PFS ON ST1I YCG DNSV 361 tggagtegtg ctgctecaga grgtaaagty gtatgtgta agt
WS R A A P E C K V V K C R F P V V E N 421 ggaaaacaga tatcaggatt tggaaaaaaa ttttactaca aagcaacagt tatgtttgaa
GKQ ISG FGKK F YY KAT VMFE 481 tgcgataagg gtttttacct cgatggcage gacacaattg tctgtgacag taacagtact Cc DK GFY LDGS DTI VCD SNST 541 tgggatecce cagttecaaa gtgtett (SEQ IDNO) SCR1-4 of Factor H 1 gaagattgca atgaacttcc tccaagaaga aatacagaaa ttctgacagg ttcetggtet
E DC NEL PPRR NTE ILT GSWS 61 dgaccaaacat atccagaagyg cacccaggct atctataaat gcegecetgg atatagatct
DOT Y PE GTÇQOQA IYK CRP Gyrs 121 cttggaaatg taataatggt atgcaggaag ggagaatggy ttgctettaa tecattaagg G GG C VvV I M VC R K L E W V A L N Q L R 181 aaatgtcaga aaaggccetg tggacatcct ggagatacte cttttggtac ttttaccctt K co KR P CGHP GDT PFG TFTL 241 acaggaggaa atgtgtttga atatggtgta aaagctgtgt atacatgtaa tgaggggtat T GG NVF EYGV KAV YTC NEGY
301 caattgctag gtgagattaa ttaccgtgaa tgtgacacag atggatggac caatgatatt
Q LL GEI NYRE C DT DGW TNDI 361 cctatatgtg aagttgtgaa gtgtttacca gtgacageac cagagaatgg aaaaattgte P Cc E V V K C P V T A P E N G K I vV 421 agtagtgcaa tggaaccag tcggtt gtggtt gt
S SA MEP DREY HF G QAV RFVC 481 aactcaggct acaagattga aggagatgaa gaaatycatt gttcagacga tggtttttgg
And SG YKI C GDE D and CS MH DGFYW 541 agtaaagaga aaccaaagtyg tgtggaaatt tcatgcaaat ccccagatgt tataaatgga SK EK PK CVEI SCK SPD VI1ING 601 tetectatat ctragaagat tatttataag gagaatgaac gatttcaata taaatgtaac SS Ss .P RKK YKE NE 1 CN 661 YK Q RF atgggttatg aatacagtga aagaggagat gctgtatgca ctgaatctgg atggegteeg
M GY EYS AND RGD AVC TES G WRP 721 ttgccttcat gtgaa (SEQ ID NO: 31) L PS CE (SEQIDNO: 15) Am4 acid and nucleic acid sequences C4BPA SCR1-3 1 aattgtggte ctecacecae tttateattt getgcccega tgaggatattac gtt
N CG PPP TLSF AAP MDI TLTE 61 acacgcttca aaactggaac tactctgaaa tacacctgcc tecetyggeta cgtceagatee
TRF KTG TTLK Y TC LPG YVRS 121 cattcaacte agacgcttac ctgtaattct gatagegaat gggtgtataa caccttectgt
HST QTL TCNS DGE WVY NTFC 181 atctacaaac gatgcagaca cccaggagag ttacgtaatg ggcaagtaga gattaagaca I Y K R C R H P GE L R N GQ YvVv E K T 241 gatttatctt ttggatcaca aatagaattc agctgttcaggta
D LS FGS QIEF SCS EGF FLIG 301 tcaaccacta gtegttgtga agtccaagat agaggagttg gctggagtca tectetecea S TT SRC EVOQOD RGV GWS HPLP
361 caatgtgaaa ttgtcaagtg taagcctect ccagacatca ggaatggaag gcacageggt
QCE IVK CKPP PDI RNG RHSG 421 gaagaaaatt tctacgcata cggecttttet gtreacetaca getgtgacee cegettetea
E EN F YA YGFS VTY SC D PRFS 481 ctcttgggco atgcctecat ttettgcact grggagaatyg aaacaatagg tgtttggaga
L LG HAS IS CT VEN E TI GVMWR 541 ccaageccete ctacctgtga a (SEQ IDNO: 32) PS P PTC E (SEQIDNO: 16) ACVP-2 amino acid sequence QCNAPEWLPFARPTNLTDEFEFPIGTYLKYECRPGYYGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHV IKDIQFGSQIKYSCTKGYRLIGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTY RCNPGSGGRKVFELVGEPSIYCTSNDDQVGINSGPAPQCIGGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHODWLNGKEYKCKVSNK ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWOQGNVFSCSVMHEALHNHYTOKSLSLSPGKGGGGGGGRPFVEMYSEIPEIIHMTEGRELVI PCRVTSPNITVTLKKFPLDTLIPDGKRIINDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHROTNTIIDV
VLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQOSGSEMKKFLSTLTIDGVTRSDO GLYTCAASSGLMTKKNSTFVRVHEK (SEQ ID NO: 33) ACVP-3 amino acid sequence QCNAPEWL PFARPTNLTDEFEFPIGTYLKYECRPGYYGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHV IKDIQFGSQIKYSCTKGYRLIGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTY RCNPGSGGRKVFELVGEPSIYCTSNDDQVGINSGPAPQCIGGGGGGGRPFVEMYSEIPEIIHMTEGRELVIPCRVT SPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHROTNTIIDVVLSPS HGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHOHKKLVNRDLKTOSGSEMKKFLSTLTIDGVTRSDOGLYTC AASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKEN WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQOPREPQVYTLP
PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQOQGNVFSCSVM HEALHNHYTOKSLSLSPGK (SEQ ID NO: 34) amino acid sequence ACVP-4 GRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRI INDSRKGFIISNATYKEIGLLTC EATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDL KTQOSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKGGGGGGQCNAPEWLPFARPTNLTDEF EFPIGTYLKYECRPGYYGRPFSIICLKNSVWIGAKDRCRRKSCRNPPDPVNGMVHVIKDIQFGSQIKYSCTKGYRL IGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSI YCTSNDDQVGIWSGPAPQCIGGGGGGDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVENAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGOPREP
QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWOQGNV FSCSVMHEALHNHYTOKSLSLSPG (SEQ ID NO: 35)
amino acid sequence ACVP-5 DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHODWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWOQGNVFSCSVMHEALHNHYTQOKSLSLSPGGG GGGGGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRI INDSRKGFIISNATYKEIG LLTCEATVNGHLYKTNYLTHROTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLV NRDLKTOSGSEMKKFLSTLTIDGVTRSDOGLYTCAASSGLMTKKNSTFVRVHEKGGGGGGQCNAPEWLPFARPTNL TDEFEFPIGTYLKYECRPGYYGRPFSIICLKNSVWIGAKDRCRRKSCRNPPDPVNGMVHVIKDIQFGSQIKYSCTK
GYRLIGSSSATCIISGNTVINDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVG EPSIYCTSNDDOVGINSGPAPQCI (SEQ ID NO: 36) ACVP-6 amino acid sequence DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHODWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWOQGNVFSCSVMHEALHNHYTQOKSLSLSPGGG GGGGQOCNAPENWLPFARPTNLTDEFEFPIGTYLKYECRPGYYGRPFSIICLKNSVWIGAKDRCRRKSCRNPPDPVNG MVHVIKDIQFGSQIKYSCTKGYRLIGSSSATCIISGNTVINDNETPICDRIPCGLPPTITNGDFISTNRENFHYGS VVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIGGGGGGGRPFVEMYSEIPEIIHMTEGRELVIP CRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFI ISNATYKEIGLLTCEATVNGHLYKTNYLTHROTNTIIDVV
LSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTOSGSEMKKFLSTLTIDGVTRSDOG LYTCAASSGLMTKKNSTFVRVHEK (SEQ ID NO: 37) amino acid sequence VEGFR-D2-2 DTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIINDSRKGFIISNATYKEIGLL
TCEATVNGHLYKTNYLTHROTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNR DLKTOSGSEMKKFLSTLT IDGVTRSDQOGLYTCAASSGLMTKKNSTFVRHE DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHODWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWOQGNVFSCSVMHEALHNHYTQOKSLSLSPGK (SEQ ID NO: 39) ACVP-1 'amino acid sequence DTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLL TCEATVNGHLYKTNYLTHROTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNR DLKTOSGSEMKKFLSTLT IDGVTRSDQOGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHODWLNGKEYK CKVSNKALPAPIEKTISKAKGQOPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVENESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWOQGNVFSCSVMHEALHNHYTQOKSLSLSPGKGGGGGGGCCNAPEWLPFARPTNLTDE FEFPIGTYLKYECRPGYYGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKDIQFGSQIKYSCTKGYR
LIGSSSATCIISGNTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPS IYCTSNDDQVGINSGPAPQCI (SEQ ID NO: 40) Human IgGl Fc amino acid sequence DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQF NSTFRVVSVLTVVHODWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF
YPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWOQGNVFSCSVMHEALHNHYTOKSLSLSPGK (SEQ ID NO: 41)
Human IgGl Fc amino acid sequence DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHODWLNGKDYKCKVSNKALPAPMOKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF
YPRHIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQOQGNVFSCSVMHEALHNHYTQOKSLSLSPGK (SEQ ID NO: 42) SP2 amino acid sequence METDTLLLWVLLLWVPGSTG (SEQ ID NO:)

权利要求:
Claims (25)
[1]
1. Fusion protein, characterized by the fact that it comprises (a) a complement inhibition domain (ICD), a VEGF inhibition domain (VID), and a domain extending half-life, or ( b) from the N-terminal to the C-terminal, a VEGF inhibition domain (VID), an immunoglobulin Fc region, and a complement inhibiting the domain (CID), in which the fusion protein inhibits complement activation and VEGF activity.
[2]
Fusion protein according to claim 1 (a), characterized in that the half-life extension domain comprises an immunoglobulin Fc region.
[3]
3. Fusion protein according to claim 2, characterized by the fact that the fusion protein comprises the referred VID, CID, and Fc from the N-terminal to the C-terminal in an order selected from the group consisting of (1) VID, Fc, CID; (2) CID, Fc, VID; (3) CID, VID, Fc; (4) VID, CID, Fc; (5) Fc, VID, CID; and (6) Fc, CID, VID.
[4]
Fusion protein according to claim 1 (b), 2 or 3, characterized in that the Fc region is a human IgG1, IgG2, IgG3 or IgG4 human Fc.
[5]
Fusion protein according to claim 1 (b), 2 or 3, characterized by the fact that the Fc region comprises the amino acid sequence of SEQ ID NO: 7 or 39, or an amino acid sequence having at least minus 90% identity with the amino acid sequence of SEQ ID NO: 7 or 39.
[6]
6. Fusion protein according to any one of claims 1 to 5, characterized by the fact that ICD comprises,
at least one short consensus repeat (SCR) of a human complement regulatory protein selected from the group consisting of CR1, Factor H, C4 - BP, DAF and MCP.
[7]
7. Fusion protein according to any one of claims 1 to 6, characterized by the fact that CID comprises an amino acid sequence selected from the group consisting of SEQ ID NO: 1 - 6 and 13-16, or an amino acid sequence having at least 90% identity with an amino acid sequence selected from the group consisting of SEQ ID NO: 1-6 and 13-16.
[8]
8. Fusion protein according to any one of claims 1 to 7, characterized in that (i) the VID comprises a portion of the extracellular domain of a human VEGF receptor, or (ii) the VID comprises a similar human immunoglobulin (Ig) domain 2 VEGFR-1 and similar human IgG domain 3 VEGFR-2, or where (Ill) VID comprises the amino acid sequence of SEQ ID NO: 11 or 38, or an amino acid sequence having at least 90% identity to the amino acid sequence of SEQ ID NO: 11 or 38.
[9]
9. Fusion protein according to any one of claims 1 to 8, characterized by the fact that (i) the fusion protein further comprises a peptide linker between domains, or where (ii) the The fusion further comprises a linker between the peptide domains and the linker peptide comprises the amino acid sequence of SEQ ID NO: 8 or an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO: 8 : 8.
[10]
10. Fusion protein according to claim 9, characterized by the fact that the peptide binding agent is between the Fe and CID region.
[11]
Fusion protein according to claim 1 (b), characterized in that the fusion protein comprises the amino acid sequence of SEQ ID NO :. 12 or 40, or an amino acid sequence having at least 90% identity with the amino acid sequence of SEQ ID NO: 12 or 40.
[12]
12. Fusion protein, characterized by the fact that it is produced by culturing a host cell comprising a nucleic acid that encodes the fusion protein according to any one of claims 1 to 11 under a condition that produces the fusion protein, and the recovery of the fusion protein produced by the host cells.
[13]
13. Dimeric fusion protein, characterized in that it comprises two fusion proteins, wherein each fusion protein comprises the fusion protein according to any one of claims 1 to 12.
[14]
14. Pharmaceutical composition, characterized in that it comprises the fusion protein as defined in any one of claims 1 to 12, and a pharmaceutically acceptable carrier.
[15]
15. Pharmaceutical composition according to claim 14, characterized by the fact that the fusion protein is a dimeric form.
[16]
16. Nucleic acid, characterized in that it encodes the fusion protein as defined in any one of claims 1 to 11, or a vector comprising said vector or a host cell comprising said nucleic acid.
[17]
17. Method of producing a fusion protein, characterized by the fact that it comprises the culture of a host cell comprising a nucleic acid encoding the fusion protein as defined in any of claims 1 to 11, under a condition that produces the fusion protein, and the recovery of the fusion protein produced by means of the host cells.
[18]
18. Method according to claim 17, characterized in that (i) the fusion protein is recovered from the cell culture medium and purified, or in (ii) the host cell is a mammalian cell or a yeast cell, or in which (Ill) the fusion protein is recovered is a dimer.
[19]
19. Fusion protein according to any of claims 1 to 13, characterized by the fact that it is for use in a method of treating an individual with an inflammatory disease, an autoimmune disease, an eye disease or cancer, the said method comprising administering to the individual an effective amount of the fusion protein.
[20]
20. Fusion protein according to claim 19, characterized by the fact that (i) the individual has rheumatoid arthritis, psoriasis, macular degeneration, diabetic retinopathy, central retinal vein occlusion, or corneal transplant, or in which (ii ) the individual has an eye disease which is macular degeneration and macular degeneration is age-related macular degeneration or age-related dry macular degeneration, or where (Ill) the individual has cancer, which is cancer breast, colorectal cancer, lung cancer, kidney cancer, gastric cancer, ovarian cancer, or retinoblastoma.
[21]
21. Fusion protein according to claim 19, characterized in that it further comprises the administration of a second therapeutic agent for the treatment of the disease.
[22]
22. Kit, characterized by the fact that it comprises the fusion protein as defined in any one of claims 1 to 13 still comprising an insert in the package, which comprises instructions for the use of the fusion protein for the treatment an inflammatory disease, an autoimmune disease, an eye disease or cancer in an individual.
[23]
23. Use of a fusion protein as defined in any one of claims 1 to 13, or a composition as defined in claim 14 or 15, characterized by the fact that it is in the manufacture or preparation of a medicament for the treatment of an individual with an inflammatory disease, an autoimmune disease, an eye disease or cancer.
[24]
24. Use according to claim 23, characterized by the fact that (i) the individual has rheumatoid arthritis, psoriasis, macular degeneration, diabetic retinopathy, central retinal vein occlusion, or corneal transplantation, or (ii) the individual has an eye disease which is macular degeneration and macular degeneration is age-related wet macular degeneration or age-related dry macular degeneration, or (iii) the individual has cancer, which is breast cancer , colorectal cancer, lung cancer, kidney cancer, gastric cancer, ovarian cancer, or retinoblastoma.
[25]
25. Use according to claim 23, characterized by the fact that said drug is intended for use in combination with a second therapeutic agent for the treatment of the disease.

类似技术:

---

公开号 | 公开日 | 专利标题

---

BR112014013205A2|2020-10-27|fusion protein, its use and production method, pharmaceutical composition, nucleic acid, and kit

---

US20200231703A1|2020-07-23|Treatment of ocular disease

---

KR102155875B1|2020-09-16|Fusion proteins for inhibiting angiogenesis

---

EA022983B1|2016-04-29|Fibronectin based scaffold domain proteins that bind pcsk9

---

US20190071477A1|2019-03-07|Recombinant complement Factor H-immunoglobulin fusion protein with complement regulatory activity, and preparation method therefor and use thereof

---

KR20190031246A|2019-03-25|Humanized monoclonal antibody targeting VE-PTP |

---

JP2020203894A|2020-12-24|Factor 1 protein and factor 2 protein and inhibitors thereof for use in treatment or prevention of diseases

---

US10927177B2|2021-02-23|Methods of treatment using anti-c-met antibodies

---

AU2012250614B2|2016-02-11|Complement factor B analogs and their uses

---

RU2702553C2|2019-10-08|New anti-human tie-2 antibody

---

JP6574431B2|2019-09-11|UTI fusion protein

---

CN112004550A|2020-11-27|Recombinant IgG Fc multimer for treating neuromyelitis optica

---

JP2021524846A|2021-09-16|Soluble complement receptor type 1 mutants and their use

---

BR112020019907A2|2021-01-05|C3-BINDING AGENTS AND METHODS OF USING THE SAME

---

TW202200606A|2022-01-01|Chimeric fusions between c4-binding protein c-terminal segment and angiopoietin-1 fibrinogen-like domain as angiopoietin mimetics and tie2 agonists to treat vascular diseases

---

WO2021173999A1|2021-09-02|Method of enhancing aqueous humor outflow and reducing intraocular pressure

---

WO2021173177A1|2021-09-02|Chimeric fusions between c4-binding protein c-terminal segment and angiopoietin-1 fibrinogen-like domain as angiopoietin mimetics and tie2 agonists to treat vascular diseases

同族专利:

---

公开号 | 公开日

---

EP2785744B1|2017-10-04|

---

WO2013082563A1|2013-06-06|

---

EP2785744A4|2015-07-22|

---

JP2015500811A|2015-01-08|

---

CA2857168C|2020-10-27|

---

AU2012318288A1|2013-06-20|

---

CN110078831A|2019-08-02|

---

DK2785744T3|2017-11-27|

---

CN104159926A|2014-11-19|

---

US20180312819A1|2018-11-01|

---

JP6138815B2|2017-05-31|

---

CN104159926B|2019-02-01|

---

CA2857168A1|2013-06-06|

---

US9988611B2|2018-06-05|

---

AU2012318288B2|2015-09-17|

---

WO2013082563A8|2014-06-26|

---

JP2017189167A|2017-10-19|

---

EP2785744A1|2014-10-08|

---

US20150079084A1|2015-03-19|

---

ES2651521T3|2018-01-26|

引用文献:

---

公开号 | 申请日 | 公开日 | 申请人 | 专利标题

---

---

USRE30985E|1978-01-01|1982-06-29|Serum-free cell culture media|

---

US4657760A|1979-03-20|1987-04-14|Ortho Pharmaceutical Corporation|Methods and compositions using monoclonal antibody to human T cells|

---

US4419446A|1980-12-31|1983-12-06|The United States Of America As Represented By The Department Of Health And Human Services|Recombinant DNA process utilizing a papilloma virus DNA as a vector|

---

NZ201705A|1981-08-31|1986-03-14|Genentech Inc|Recombinant dna method for production of hepatitis b surface antigen in yeast|

---

US4601978A|1982-11-24|1986-07-22|The Regents Of The University Of California|Mammalian metallothionein promoter system|

---

US4560655A|1982-12-16|1985-12-24|Immunex Corporation|Serum-free cell culture medium and process for making same|

---

US4657866A|1982-12-21|1987-04-14|Sudhir Kumar|Serum-free, synthetic, completely chemically defined tissue culture media|

---

DD266710A3|1983-06-06|1989-04-12|Ve Forschungszentrum Biotechnologie|Process for the biotechnical production of alkaline phosphatase|

---

US4767704A|1983-10-07|1988-08-30|Columbia University In The City Of New York|Protein-free culture medium|

---

US4879231A|1984-10-30|1989-11-07|Phillips Petroleum Company|Transformation of yeasts of the genus pichia|

---

US5206344A|1985-06-26|1993-04-27|Cetus Oncology Corporation|Interleukin-2 muteins and polymer conjugation thereof|

---

GB8516415D0|1985-06-28|1985-07-31|Celltech Ltd|Culture of animal cells|

---

US4927762A|1986-04-01|1990-05-22|Cell Enterprises, Inc.|Cell culture medium with antioxidant|

---

GB8610600D0|1986-04-30|1986-06-04|Novo Industri As|Transformation of trichoderma|

---

IL89790A|1988-04-01|2002-05-23|Johns Hopking University|Nucleic acid sequences that encode and cells that produce cr1 protein and methods of production and purification|

---

JP2783294B2|1988-09-23|1998-08-06|カイロンコーポレーション|Cell culture media for enhanced cell growth, culture life and product expression|

---

FR2646437B1|1989-04-28|1991-08-30|Transgene Sa|NOVEL DNA SEQUENCES, THEIR APPLICATION AS A SEQUENCE ENCODING A SIGNAL PEPTIDE FOR THE SECRETION OF MATURE PROTEINS BY RECOMBINANT YEASTS, EXPRESSION CASSETTES, PROCESSED YEASTS AND PROCESS FOR PREPARING THE SAME|

---

EP0402226A1|1989-06-06|1990-12-12|Institut National De La Recherche Agronomique|Transformation vectors for yeast yarrowia|

---

US5225212A|1989-10-20|1993-07-06|Liposome Technology, Inc.|Microreservoir liposome composition and method|

---

US5122469A|1990-10-03|1992-06-16|Genentech, Inc.|Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins|

---

WO1995008343A1|1993-09-24|1995-03-30|Washington University|Modified truncated complement system regulators|

---

US7018809B1|1991-09-19|2006-03-28|Genentech, Inc.|Expression of functional antibody fragments|

---

DE69329503T2|1992-11-13|2001-05-03|Idec Pharma Corp|Therapeutic use of chimeric and labeled antibodies directed against a differentiation antigen, the expression of which is restricted to human B lymphocyte, for the treatment of B cell lymphoma|

---

US5789199A|1994-11-03|1998-08-04|Genentech, Inc.|Process for bacterial production of polypeptides|

---

US5840523A|1995-03-01|1998-11-24|Genetech, Inc.|Methods and compositions for secretion of heterologous polypeptides|

---

GB9614871D0|1996-07-15|1996-09-04|Smithkline Beecham Plc|Compounds|

---

MEP3208A|1999-06-08|2010-02-10|Regeneron Pharma|Modified chimeric polypeptides with improved pharmacokinetic properties|

---

US7087411B2|1999-06-08|2006-08-08|Regeneron Pharmaceuticals, Inc.|Fusion protein capable of binding VEGF|

---

EP1307552A2|2000-08-01|2003-05-07|Amgen Inc.|C3b/C4b COMPLEMENT RECEPTOR-LIKE MOLECULES AND USES THEREOF|

---

CA2624189A1|2005-10-03|2007-04-12|Xencor, Inc.|Fc variants with optimized fc receptor binding properties|

---

EP1569685B8|2002-11-15|2012-12-05|MUSC Foundation For Research Development|Complement receptor 2 targeted complement modulators|

---

US20060134105A1|2004-10-21|2006-06-22|Xencor, Inc.|IgG immunoglobulin variants with optimized effector function|

---

WO2006088650A2|2005-02-02|2006-08-24|Regeneron Pharmaceuticals, Inc.|Method of treating eye injury with local administration of a vegf inhibitor|

---

EP2662089A3|2005-10-08|2014-02-19|Potentia Pharmaceuticals, Inc.|Compstatin and analogs thereof for eye disorders|

---

US8168584B2|2005-10-08|2012-05-01|Potentia Pharmaceuticals, Inc.|Methods of treating age-related macular degeneration by compstatin and analogs thereof|

---

US7759304B2|2006-06-21|2010-07-20|Regents Of The University Of Colorado|Targeting complement factor H for treatment of diseases|

---

CA2666843C|2006-10-20|2015-06-16|Celldex Therapeutics, Inc.|Treatment of age-related macular degeneration and other diseases of the eye|

---

US8268314B2|2008-10-08|2012-09-18|Hoffmann-La Roche Inc.|Bispecific anti-VEGF/anti-ANG-2 antibodies|

---

US8927232B2|2008-12-11|2015-01-06|Korea Advanced Institute Of Science And Technology |Fusion protein capable of binding VEGF-A and TNF-alpha|CN104721820A|2013-12-24|2015-06-24|信达生物制药有限公司|Application of bispecific monoclonal antibody to treatment of uveitis|

---

NZ724196A|2014-02-24|2022-01-28|Takeda Pharmaceuticals Co|Uti fusion proteins|

---

WO2015148416A1|2014-03-24|2015-10-01|Deqiang Jing|Novel recombinant bi-functional fusion proteins, preparation and use thereof|

---

US10155983B2|2014-03-31|2018-12-18|Machaon Diagnostics, Inc.|Method of diagnosis of complement-mediated thrombotic microangiopathies|

---

US9840553B2|2014-06-28|2017-12-12|Kodiak Sciences Inc.|Dual PDGF/VEGF antagonists|

---

CN105327346B|2014-08-07|2019-10-18|信达生物制药有限公司|A kind of application of monoclonal antibody in treatment psoriasis|

---

CN105435222B|2014-09-25|2018-05-29|信达生物制药有限公司|Recombination fusion protein preparation|

---

CN104940926B|2014-09-25|2017-09-22|信达生物制药有限公司|Recombination fusion protein preparation|

---

CN106084062B|2015-04-28|2021-04-02|荣昌生物制药（烟台）有限公司|Bridged bispecific fusion proteins|

---

EP3313426B1|2015-06-28|2020-04-29|Allgenesis Biotherapeutics Inc.|Fusion proteins for inhibiting angiogenesis|

---

EP3377101A4|2015-11-19|2019-08-07|Zhuhai Tairuishang Biopharm Ltd.|Methods and compositions for binding vegf|

---

CN106890313A|2015-12-18|2017-06-27|信达生物制药有限公司|Medicine for treating pathological myopia|

---

EP3397276A4|2015-12-30|2019-12-18|Kodiak Sciences Inc.|Antibodies and conjugates thereof|

---

US20190071477A1|2015-12-31|2019-03-07|Quassia Biopharma Co., Ltd|Recombinant complement Factor H-immunoglobulin fusion protein with complement regulatory activity, and preparation method therefor and use thereof|

---

KR101685532B1|2016-04-26|2016-12-13|한국프라임제약주식회사|A VEGFR fusion protein|

---

CN107602702A|2017-09-22|2018-01-19|生标（上海）医疗器械科技有限公司|Antibody that is a kind of while targetting people p185 and VEGF and its application|

---

GB201800620D0|2018-01-15|2018-02-28|Univ Manchester|C3b Binding Polypeptide|

---

JP2022512657A|2018-10-12|2022-02-07|トリカン・バイオテクノロジー・カンパニー・リミテッド|Bifunctional fusion protein and its use|

---

GB2583560A|2018-12-11|2020-11-04|Admirx Inc|Fusion protein constructs for complement associated disease|

---

CN111378044A|2018-12-28|2020-07-07|长春金赛药业有限责任公司|Antibody fusion protein, preparation method and application thereof|

---

TW202128746A|2019-12-24|2021-08-01|大陸商信達生物製藥（蘇州）有限公司|Use of fusion protein for the treatment of age-related macular degeneration|

---

WO2022010273A1|2020-07-07|2022-01-13|주식회사 카나프테라퓨틱스|Fusion proteins comprising complement pathway inhibitor and use thereof|

法律状态:
2020-11-03| B08F| Application dismissed because of non-payment of annual fees [chapter 8.6 patent gazette]|Free format text: REFERENTE A 7A ANUIDADE. |

---

2021-02-23| B08K| Patent lapsed as no evidence of payment of the annual fee has been furnished to inpi [chapter 8.11 patent gazette]|Free format text: EM VIRTUDE DO ARQUIVAMENTO PUBLICADO NA RPI 2600 DE 03-11-2020 E CONSIDERANDO AUSENCIA DE MANIFESTACAO DENTRO DOS PRAZOS LEGAIS, INFORMO QUE CABE SER MANTIDO O ARQUIVAMENTO DO PEDIDO DE PATENTE, CONFORME O DISPOSTO NO ARTIGO 12, DA RESOLUCAO 113/2013. |

---

2021-12-07| B350| Update of information on the portal [chapter 15.35 patent gazette]|

优先权:

---

申请号 | 申请日 | 专利标题

---

US201161629932P| true| 2011-12-01|2011-12-01|

---

US61/629,932|2011-12-01|

---

PCT/US2012/067489|WO2013082563A1|2011-12-01|2012-11-30|Protein inhibitors to complement and vegf pathways and methods of use thereof|

---